BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_H23 (806 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 25 0.83 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 25 0.83 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 3.3 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 23 4.4 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 25.0 bits (52), Expect = 0.83 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = -3 Query: 342 PADRPSRSAYSTIGRSXPG-DPCEPQSKPYNVVQETRKRKGLKEGLP 205 P + PS Y+ + S G + + S+PY + KG KEG+P Sbjct: 567 PDEVPSDVLYNRLVVSEDGSETFKYSSQPYGFPERLLLPKGKKEGMP 613 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 25.0 bits (52), Expect = 0.83 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = -3 Query: 342 PADRPSRSAYSTIGRSXPG-DPCEPQSKPYNVVQETRKRKGLKEGLP 205 P + PS Y+ + S G + + S+PY + KG KEG+P Sbjct: 567 PDEVPSDVLYNRLVVSEDGSETFKYSSQPYGFPERLLLPKGKKEGMP 613 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 23.0 bits (47), Expect = 3.3 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +3 Query: 654 NTTQXSSAITPP 689 NTTQ +SA TPP Sbjct: 679 NTTQNASATTPP 690 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 22.6 bits (46), Expect = 4.4 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -2 Query: 631 HSILMPSIEVVAKSFQQLEDACTHVC*LLSPV 536 HS+L + VVA S + + T++ +L PV Sbjct: 939 HSVLHSAQSVVASSASNVTNVTTNLTTILPPV 970 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 210,486 Number of Sequences: 438 Number of extensions: 4684 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25610547 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -