BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_H16 (875 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY045760-2|AAK84943.1| 169|Anopheles gambiae D7-related 3 prote... 24 5.3 AJ133854-1|CAB39729.1| 169|Anopheles gambiae D7-related 3 prote... 24 5.3 AJ000035-1|CAA03871.1| 156|Anopheles gambiae D7r3 protein protein. 24 5.3 AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. 23 9.2 AY045760-4|AAK84945.1| 165|Anopheles gambiae D7-related 4 prote... 23 9.2 AJ302659-1|CAC35524.1| 165|Anopheles gambiae D7r4 protein protein. 23 9.2 >AY045760-2|AAK84943.1| 169|Anopheles gambiae D7-related 3 protein protein. Length = 169 Score = 24.2 bits (50), Expect = 5.3 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +2 Query: 335 CVRNGRYSIRSRLCEVRRTRPL 400 C RN S++ R+CE+R+ P+ Sbjct: 30 CERNIPASLKERVCELRQYTPV 51 >AJ133854-1|CAB39729.1| 169|Anopheles gambiae D7-related 3 protein protein. Length = 169 Score = 24.2 bits (50), Expect = 5.3 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +2 Query: 335 CVRNGRYSIRSRLCEVRRTRPL 400 C RN S++ R+CE+R+ P+ Sbjct: 30 CERNIPASLKERVCELRQYTPV 51 >AJ000035-1|CAA03871.1| 156|Anopheles gambiae D7r3 protein protein. Length = 156 Score = 24.2 bits (50), Expect = 5.3 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +2 Query: 335 CVRNGRYSIRSRLCEVRRTRPL 400 C RN S++ R+CE+R+ P+ Sbjct: 30 CERNIPASLKERVCELRQYTPV 51 >AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. Length = 1132 Score = 23.4 bits (48), Expect = 9.2 Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 4/30 (13%) Frame = -1 Query: 620 QPIIAXLYPRPGWSTAPG----GAGR*RLQ 543 +P++ PRPG PG GA R RL+ Sbjct: 490 EPVLFKYKPRPGMMVVPGAGASGASRKRLR 519 >AY045760-4|AAK84945.1| 165|Anopheles gambiae D7-related 4 protein protein. Length = 165 Score = 23.4 bits (48), Expect = 9.2 Identities = 8/11 (72%), Positives = 11/11 (100%) Frame = +2 Query: 356 SIRSRLCEVRR 388 S++SRLCE+RR Sbjct: 34 SLKSRLCEIRR 44 >AJ302659-1|CAC35524.1| 165|Anopheles gambiae D7r4 protein protein. Length = 165 Score = 23.4 bits (48), Expect = 9.2 Identities = 8/11 (72%), Positives = 11/11 (100%) Frame = +2 Query: 356 SIRSRLCEVRR 388 S++SRLCE+RR Sbjct: 34 SLKSRLCEIRR 44 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 695,479 Number of Sequences: 2352 Number of extensions: 11943 Number of successful extensions: 23 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 93853377 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -