BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_H15 (792 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 22 4.9 AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cogna... 22 6.5 AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock prote... 22 6.5 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 22.2 bits (45), Expect = 4.9 Identities = 12/44 (27%), Positives = 21/44 (47%) Frame = +1 Query: 646 IAFFVRIGSYDVTPGPYYTHTVSCXLGRIVXKSVPXPXCEVSPQ 777 +A FVR+ ++ + G Y HT + +V S +V P+ Sbjct: 150 VADFVRVEAWVGSDGSLYNHTANYDSKYLVLPSGELHIRDVGPE 193 >AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cognate 70 protein. Length = 196 Score = 21.8 bits (44), Expect = 6.5 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = -3 Query: 391 VAQYLQNRYKSVHKTEISGSDWHCFRIET 305 + +Y +K HK +ISG+ R+ T Sbjct: 65 LVEYCTQDFKKKHKADISGNPRALRRLRT 93 >AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock protein 70 protein. Length = 196 Score = 21.8 bits (44), Expect = 6.5 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = -3 Query: 391 VAQYLQNRYKSVHKTEISGSDWHCFRIET 305 + +Y +K HK +ISG+ R+ T Sbjct: 65 LVEYCTQDFKKKHKADISGNPRALRRLRT 93 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,806 Number of Sequences: 336 Number of extensions: 3301 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21480183 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -