BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_H15 (792 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC12C2.10c |pst1|SPBC21D10.01c|Clr6 histone deacetylase comple... 29 0.58 SPCC1682.03c |mug174||meiotically upregulated gene Mug174|Schizo... 28 1.8 SPBC1861.04c |||RNA-binding protein Prp24|Schizosaccharomyces po... 26 5.4 SPCC1020.13c ||SPCC14G10.05|phospholipase |Schizosaccharomyces p... 25 9.4 >SPBC12C2.10c |pst1|SPBC21D10.01c|Clr6 histone deacetylase complex subunit Pst1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1522 Score = 29.5 bits (63), Expect = 0.58 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -2 Query: 584 VSPRHHTKKTRTATSLMPSPTARA 513 V R+H+K+TRTATS + T RA Sbjct: 478 VQTRNHSKRTRTATSSVEETTPRA 501 >SPCC1682.03c |mug174||meiotically upregulated gene Mug174|Schizosaccharomyces pombe|chr 3|||Manual Length = 626 Score = 27.9 bits (59), Expect = 1.8 Identities = 24/100 (24%), Positives = 44/100 (44%), Gaps = 5/100 (5%) Frame = -3 Query: 613 TKIFGTLCCQFHLVIIPRKLEQLHL*--CHPRQHGRDSNLQLSIQEP---ILQSVQQPIP 449 +K + Q ++ P ++++ L PR DS + P I Q P Sbjct: 133 SKFMNSKASQKQQMLSPETMQKVDLAGRASPRYQANDSWISKKRNAPLSSISQYANMPEN 192 Query: 448 VSIPAARNVLPN*DLLIQAVAQYLQNRYKSVHKTEISGSD 329 ++ ++ + N + I A + QN+Y+S+H +IS SD Sbjct: 193 YALNTKKSKISNENDTIFK-ANFQQNKYESLHAKQISASD 231 >SPBC1861.04c |||RNA-binding protein Prp24|Schizosaccharomyces pombe|chr 2|||Manual Length = 1014 Score = 26.2 bits (55), Expect = 5.4 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +1 Query: 268 KYCYVLIYFTLKKSLYENSANLNLRFRFCEQI 363 KY L TLKKSLY+N L F+F + I Sbjct: 474 KYNPELAAETLKKSLYKNVDQPQLLFQFYQSI 505 >SPCC1020.13c ||SPCC14G10.05|phospholipase |Schizosaccharomyces pombe|chr 3|||Manual Length = 669 Score = 25.4 bits (53), Expect = 9.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -2 Query: 671 DPILTKKAIPRAVPLXLRNHENIRDFVLPVS 579 DP++ P+ +P+ RN N ++ PV+ Sbjct: 284 DPLIRNDYEPQLLPICWRNKLNFNSYIKPVA 314 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,789,913 Number of Sequences: 5004 Number of extensions: 54369 Number of successful extensions: 108 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 106 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 108 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 385381248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -