BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_H15 (792 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g05800.1 68414.m00606 lipase class 3 family protein similar t... 29 4.7 At5g05530.1 68418.m00600 zinc finger (C3HC4-type RING finger) fa... 28 8.2 >At1g05800.1 68414.m00606 lipase class 3 family protein similar to DEFECTIVE IN ANTHER DEHISCENCE1 [Arabidopsis thaliana] GI:16215706; contains Pfam profile PF01764: Lipase Length = 471 Score = 28.7 bits (61), Expect = 4.7 Identities = 18/64 (28%), Positives = 26/64 (40%) Frame = -1 Query: 729 PSKXTRNCMCVIRPRRNVIGSNPYEKGYPACSTFXLTESRKYSGLCVASFTSSSYQENSN 550 PS+ + + R R + GSN +E S E +Y L AS+ NS Sbjct: 70 PSRAPAVTLPLSRVWREIQGSNNWENLIEPLSPILQQEITRYGNLLSASYKGFDLNPNSK 129 Query: 549 SYIS 538 Y+S Sbjct: 130 RYLS 133 >At5g05530.1 68418.m00600 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 199 Score = 27.9 bits (59), Expect = 8.2 Identities = 15/49 (30%), Positives = 21/49 (42%) Frame = +3 Query: 399 MRRSQFGSTFLAAGIDTGIGCCTDCKIGSCIDSCRFESRPCCRGWH*RC 545 M S+ +T + A T + CT C C D E+ CC +H C Sbjct: 127 MEESKGWTTCIPAKSITPVNECTICLEELCHDEESIETHDCCHVFHKLC 175 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,221,738 Number of Sequences: 28952 Number of extensions: 272801 Number of successful extensions: 588 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 572 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 587 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1785055200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -