BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_H11 (823 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_10782| Best HMM Match : No HMM Matches (HMM E-Value=.) 323 9e-89 SB_20217| Best HMM Match : Amidase (HMM E-Value=2.3e-21) 30 2.6 SB_44329| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_3989| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_7301| Best HMM Match : S-antigen (HMM E-Value=2.1) 29 4.6 SB_52551| Best HMM Match : NUC130_3NT (HMM E-Value=6.4) 28 8.0 SB_36169| Best HMM Match : DUF676 (HMM E-Value=0) 28 8.0 SB_20967| Best HMM Match : FDX-ACB (HMM E-Value=2.2e-07) 28 8.0 SB_45720| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 SB_8500| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 >SB_10782| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 399 Score = 323 bits (794), Expect = 9e-89 Identities = 144/188 (76%), Positives = 167/188 (88%) Frame = -3 Query: 614 GYRYDWKIGEAQKNLLRTHTTAVSARMLYRLAQQTEFTPQKYFSIDKVFRNETLDATHLA 435 GY+Y+WK EA+KNLLRTHTTAVSARMLY+L QQ +FTP K+FSID+VFRNETLDATHLA Sbjct: 211 GYQYEWKTEEAKKNLLRTHTTAVSARMLYKLGQQEKFTPAKFFSIDRVFRNETLDATHLA 270 Query: 434 EFHQVEGVVADRGLGLADLITVLDAFFKRLGFDQLQFKPAYNPYTEPSMEIFAYHTGLAK 255 EFHQ+EG+VADR L L DLI L FF++LG +L+FKPAYNPYTEPSME+F+YH GL K Sbjct: 271 EFHQIEGLVADRNLTLGDLIGTLHQFFRKLGITKLRFKPAYNPYTEPSMEVFSYHEGLKK 330 Query: 254 WIEIGNSGVFRPEMLLPMGLPEDVNVIAWGLSLERPTMIKYGLNNIRDLVGPKVDLRMVY 75 W+E+GNSGVFRPEML PMGLP+DV+VIAWGLSLERPTMIKYG++NIRDL+G KVDL MVY Sbjct: 331 WVEVGNSGVFRPEMLRPMGLPDDVSVIAWGLSLERPTMIKYGISNIRDLIGHKVDLDMVY 390 Query: 74 NNPICRLD 51 NPIC L+ Sbjct: 391 RNPICLLE 398 >SB_20217| Best HMM Match : Amidase (HMM E-Value=2.3e-21) Length = 457 Score = 29.9 bits (64), Expect = 2.6 Identities = 35/147 (23%), Positives = 59/147 (40%) Frame = +3 Query: 102 PDQVPDVVEPVLDHGGPLEGQAPRYHVHVLRQAHGQQHLRSEHPRITNLYPFGETGVVCE 281 PD+ VV VLD GG + G+A + + G + P + L ETG Sbjct: 124 PDEDATVVTRVLDAGGTIVGKAVCEELSI----SGSSFTAATGPVMNPLDNRRETG---- 175 Query: 282 YFHAGFGVGVVRRLELQLVEAEPLEEGVQHGDEVGEPEPAVRDHALHLVELRQVGGVQGL 461 + G G + ++ + L EG H + + + V++ ++ L E R V G+ Sbjct: 176 --GSSSGCGALLNGDISGIRIGLLREGFGHQNSEEDVDRIVKEASIRLAE-RTGHEVVGI 232 Query: 462 VAEHLIDAEVLLRSELCLLRQPVQHPG 542 + LL + C+ + V H G Sbjct: 233 SVPMHLQGSALLTAISCIGGRRVLHDG 259 >SB_44329| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 423 Score = 29.5 bits (63), Expect = 3.4 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = -3 Query: 332 LQFKPAYNPYTEPSMEIFAYHTGLAKWIEIGNSGVFRPEMLL 207 L ++ N Y E + E A H G+ KW GN F P +L Sbjct: 222 LSYRQRLNVYKE-NWEKLAVHFGILKWASTGNLEKFSPAEIL 262 >SB_3989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1283 Score = 29.1 bits (62), Expect = 4.6 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 2/53 (3%) Frame = +3 Query: 81 HAQVDLGPDQVPDVVEPVLDHGGPLEGQAPRYHVHVLRQAHG--QQHLRSEHP 233 H ++ GP ++P + H GP +G + VH R H +HL EHP Sbjct: 897 HPFIEQGPVEIP------ISHSGPWQGDIDSHMVHADRHLHDHPDRHLH-EHP 942 >SB_7301| Best HMM Match : S-antigen (HMM E-Value=2.1) Length = 682 Score = 29.1 bits (62), Expect = 4.6 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 2/53 (3%) Frame = +3 Query: 81 HAQVDLGPDQVPDVVEPVLDHGGPLEGQAPRYHVHVLRQAHG--QQHLRSEHP 233 H ++ GP ++P + H GP +G + VH R H +HL EHP Sbjct: 30 HPFIEQGPVEIP------ISHSGPWQGDIDSHMVHADRHLHDHPDRHLH-EHP 75 >SB_52551| Best HMM Match : NUC130_3NT (HMM E-Value=6.4) Length = 363 Score = 28.3 bits (60), Expect = 8.0 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = -3 Query: 284 IFAYHTGLAK-WIEIGNSGVFRPEMLLPMGLPEDVNVIAWGLSLE 153 I+ + GLA+ W+ + N VFRP+ + +G E V + L LE Sbjct: 220 IYTSNPGLAEGWVAVNNKVVFRPDSMDSLG-KEQVGFLLDPLGLE 263 >SB_36169| Best HMM Match : DUF676 (HMM E-Value=0) Length = 2442 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/51 (29%), Positives = 25/51 (49%) Frame = +1 Query: 100 GPTRSRMLLSPYLIMVGRSRDRPHAITFTSSGRPMGSSISGLNTPELPISI 252 GP + + L L+ G SR + FTS+ P S +TP+ P+++ Sbjct: 1291 GPAKRQQSLGISLLQTGPSRSALPSSFFTSTPMPGTPRTSERSTPDTPLNL 1341 >SB_20967| Best HMM Match : FDX-ACB (HMM E-Value=2.2e-07) Length = 318 Score = 28.3 bits (60), Expect = 8.0 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -3 Query: 473 VFRNETLDATHLAEFHQVEGV 411 V+R + +D+ H FHQ+EGV Sbjct: 183 VYRRDEIDSCHYPVFHQMEGV 203 >SB_45720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/50 (28%), Positives = 20/50 (40%) Frame = -2 Query: 216 DAAAHGPA*GRERDSVGPVPRAAHHDQVRAQQHPGPGRAQGRPAHGLQQP 67 + AH P E + G P HH++ HP PG+ G+ P Sbjct: 131 ERGAHPPGQHHEEEERGAHPPGQHHEEEERGVHP-PGQHHEEEERGVHPP 179 >SB_8500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3408 Score = 28.3 bits (60), Expect = 8.0 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = -3 Query: 284 IFAYHTGLAK-WIEIGNSGVFRPEMLLPMGLPEDVNVIAWGLSLE 153 I+ + GLA+ W+ + N VFRP+ + +G E V + L LE Sbjct: 4 IYTSNPGLAEGWVAVNNKVVFRPDSMDSLG-KEQVGFLLDPLGLE 47 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,342,381 Number of Sequences: 59808 Number of extensions: 490529 Number of successful extensions: 1414 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1268 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1406 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2299585728 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -