BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_H03 (877 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g02880.1 68418.m00231 HECT-domain-containing protein / ubiqui... 28 7.1 At4g13960.1 68417.m02159 F-box family protein contains F-box dom... 28 9.4 >At5g02880.1 68418.m00231 HECT-domain-containing protein / ubiquitin-transferase family protein / armadillo/beta-catenin-like repeat-containing protein similar to SP|Q14669 Thyroid receptor interacting protein 12 (TRIP12) {Homo sapiens}; contains Pfam profiles PF00632: HECT-domain (ubiquitin-transferase), PF00514: Armadillo/beta-catenin-like repeat Length = 1502 Score = 28.3 bits (60), Expect = 7.1 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = +2 Query: 239 LVPEVPVKRRLLNPQPFRQFACRQTVYADLXSTGPGXARI 358 +V E+P +R N Q FR +V A T PG + Sbjct: 11 VVEELPADKRACNSQDFRPSTSGSSVQAQANDTNPGHENV 50 >At4g13960.1 68417.m02159 F-box family protein contains F-box domain Pfam:PF00646 Length = 434 Score = 27.9 bits (59), Expect = 9.4 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +3 Query: 720 RTRLPPICVNGAELLRHFGKSR*FGAKQL 806 + R+P +C AE++ H+GKS F + L Sbjct: 394 KLRVPQVCEFIAEMMEHYGKSSSFNVQLL 422 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,670,196 Number of Sequences: 28952 Number of extensions: 384145 Number of successful extensions: 867 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 842 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 867 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 2058178400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -