BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_G22 (836 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g43250.1 68415.m05375 expressed protein and genefinder 30 2.2 At3g11670.2 68416.m01431 digalactosyldiacylglycerol synthase 1 (... 29 5.1 At3g11670.1 68416.m01430 digalactosyldiacylglycerol synthase 1 (... 29 5.1 >At2g43250.1 68415.m05375 expressed protein and genefinder Length = 625 Score = 29.9 bits (64), Expect = 2.2 Identities = 18/52 (34%), Positives = 26/52 (50%) Frame = +2 Query: 380 SSRCHVQFRRASVTR*IYTLHSGHLQNGHKIFHTSIRVLFRCSVVGVFKEAK 535 SSR VQF + S Y L + L+N K F + ++ CS+ G+ K K Sbjct: 336 SSRTEVQFSQLSSEDKSYALMADLLRNQAKKFKNIVAIVDACSLAGLRKHWK 387 >At3g11670.2 68416.m01431 digalactosyldiacylglycerol synthase 1 (DGD1) / MGDG:MGDG galactosyltransferase / galactolipid galactosyltransferase identical to digalactosyldiacylglycerol synthase (DGD1) GI:5354158 [Arabidopsis thaliana] Length = 639 Score = 28.7 bits (61), Expect = 5.1 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +3 Query: 609 VDHVNDWVVRFFLDRALR 662 V+HVN+WV R + D+ LR Sbjct: 508 VNHVNNWVTRAYCDKVLR 525 >At3g11670.1 68416.m01430 digalactosyldiacylglycerol synthase 1 (DGD1) / MGDG:MGDG galactosyltransferase / galactolipid galactosyltransferase identical to digalactosyldiacylglycerol synthase (DGD1) GI:5354158 [Arabidopsis thaliana] Length = 808 Score = 28.7 bits (61), Expect = 5.1 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +3 Query: 609 VDHVNDWVVRFFLDRALR 662 V+HVN+WV R + D+ LR Sbjct: 508 VNHVNNWVTRAYCDKVLR 525 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,420,840 Number of Sequences: 28952 Number of extensions: 273601 Number of successful extensions: 526 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 513 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 526 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1931371200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -