BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_G18 (841 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) 235 2e-62 SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) 235 2e-62 SB_56| Best HMM Match : Actin (HMM E-Value=0) 235 2e-62 SB_56628| Best HMM Match : Actin (HMM E-Value=0) 235 3e-62 SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) 233 1e-61 SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) 233 1e-61 SB_13344| Best HMM Match : Actin (HMM E-Value=1.5e-07) 205 4e-53 SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10) 75 5e-14 SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07) 69 4e-12 SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 5e-12 SB_54| Best HMM Match : Actin (HMM E-Value=0) 55 8e-08 SB_22343| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40) 38 0.010 SB_42882| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 30 2.7 SB_5589| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_50207| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.2 SB_38754| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.2 SB_9926| Best HMM Match : DPPIV_N (HMM E-Value=0) 28 8.2 >SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 235 bits (576), Expect = 2e-62 Identities = 108/114 (94%), Positives = 112/114 (98%) Frame = -3 Query: 635 FQPSFLGMEACGIHETTYNSVMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALA 456 FQPSFLGME+ GIHETTYNS+MKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEI+ALA Sbjct: 225 FQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEISALA 284 Query: 455 PSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 294 P TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP+IVHRKCF Sbjct: 285 PPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPAIVHRKCF 338 Score = 33.9 bits (74), Expect = 0.17 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -1 Query: 703 YELPDGQVITIGNXKIPLP 647 YELPDGQVITIGN + P Sbjct: 203 YELPDGQVITIGNERFRCP 221 Score = 33.5 bits (73), Expect = 0.22 Identities = 19/43 (44%), Positives = 21/43 (48%) Frame = -2 Query: 735 TXASSXSLEXFTNFPTVRSSPSETXRFRCPEALFPTXVLGYGS 607 T ASS SLE P + RFRCPEA+F LG S Sbjct: 192 TAASSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMES 234 >SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 235 bits (576), Expect = 2e-62 Identities = 108/114 (94%), Positives = 112/114 (98%) Frame = -3 Query: 635 FQPSFLGMEACGIHETTYNSVMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALA 456 FQPSFLGME+ GIHETTYNS+MKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEIT+LA Sbjct: 263 FQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITSLA 322 Query: 455 PSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 294 P TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 323 PPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376 Score = 33.9 bits (74), Expect = 0.17 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -1 Query: 703 YELPDGQVITIGNXKIPLP 647 YELPDGQVITIGN + P Sbjct: 241 YELPDGQVITIGNERFRCP 259 Score = 33.5 bits (73), Expect = 0.22 Identities = 19/43 (44%), Positives = 21/43 (48%) Frame = -2 Query: 735 TXASSXSLEXFTNFPTVRSSPSETXRFRCPEALFPTXVLGYGS 607 T ASS SLE P + RFRCPEA+F LG S Sbjct: 230 TAASSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMES 272 >SB_56| Best HMM Match : Actin (HMM E-Value=0) Length = 375 Score = 235 bits (576), Expect = 2e-62 Identities = 108/114 (94%), Positives = 112/114 (98%) Frame = -3 Query: 635 FQPSFLGMEACGIHETTYNSVMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALA 456 FQPSFLGME+ GIHETTYNS+MKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEIT+LA Sbjct: 262 FQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITSLA 321 Query: 455 PSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 294 P TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 322 PPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 Score = 33.9 bits (74), Expect = 0.17 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -1 Query: 703 YELPDGQVITIGNXKIPLP 647 YELPDGQVITIGN + P Sbjct: 240 YELPDGQVITIGNERFRCP 258 Score = 33.5 bits (73), Expect = 0.22 Identities = 19/43 (44%), Positives = 21/43 (48%) Frame = -2 Query: 735 TXASSXSLEXFTNFPTVRSSPSETXRFRCPEALFPTXVLGYGS 607 T ASS SLE P + RFRCPEA+F LG S Sbjct: 229 TAASSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMES 271 >SB_56628| Best HMM Match : Actin (HMM E-Value=0) Length = 376 Score = 235 bits (575), Expect = 3e-62 Identities = 108/114 (94%), Positives = 112/114 (98%) Frame = -3 Query: 635 FQPSFLGMEACGIHETTYNSVMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALA 456 FQPSFLGME+ GIHETTYNS+MKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKEI+ALA Sbjct: 263 FQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISALA 322 Query: 455 PSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 294 P TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 323 PPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376 Score = 33.9 bits (74), Expect = 0.17 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -1 Query: 703 YELPDGQVITIGNXKIPLP 647 YELPDGQVITIGN + P Sbjct: 241 YELPDGQVITIGNERFRCP 259 Score = 33.5 bits (73), Expect = 0.22 Identities = 19/43 (44%), Positives = 21/43 (48%) Frame = -2 Query: 735 TXASSXSLEXFTNFPTVRSSPSETXRFRCPEALFPTXVLGYGS 607 T ASS SLE P + RFRCPEA+F LG S Sbjct: 230 TAASSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMES 272 >SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 233 bits (571), Expect = 1e-61 Identities = 107/114 (93%), Positives = 112/114 (98%) Frame = -3 Query: 635 FQPSFLGMEACGIHETTYNSVMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALA 456 FQPSFLGME+ GIHETTYNS+MKCDVDIRKDLYANTVLSGG+TM+PGIADRMQKEI+ALA Sbjct: 262 FQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEISALA 321 Query: 455 PSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 294 P TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 322 PPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 Score = 33.9 bits (74), Expect = 0.17 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -1 Query: 703 YELPDGQVITIGNXKIPLP 647 YELPDGQVITIGN + P Sbjct: 240 YELPDGQVITIGNERFRCP 258 Score = 32.3 bits (70), Expect = 0.50 Identities = 18/43 (41%), Positives = 21/43 (48%) Frame = -2 Query: 735 TXASSXSLEXFTNFPTVRSSPSETXRFRCPEALFPTXVLGYGS 607 T A+S SLE P + RFRCPEA+F LG S Sbjct: 229 TAAASSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMES 271 >SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 349 Score = 233 bits (570), Expect = 1e-61 Identities = 106/113 (93%), Positives = 112/113 (99%) Frame = -3 Query: 632 QPSFLGMEACGIHETTYNSVMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAP 453 QPSFLGME+ GIHETTYNS+MKCDVDIRKDLYANTV+SGGTTMYPG+ADRMQKEI+ALAP Sbjct: 237 QPSFLGMESSGIHETTYNSIMKCDVDIRKDLYANTVMSGGTTMYPGLADRMQKEISALAP 296 Query: 452 STMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 294 STMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP+IVHRKCF Sbjct: 297 STMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPAIVHRKCF 349 Score = 33.9 bits (74), Expect = 0.17 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -1 Query: 703 YELPDGQVITIGNXKIPLP 647 YELPDGQVITIGN + P Sbjct: 214 YELPDGQVITIGNERFRCP 232 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/43 (41%), Positives = 20/43 (46%) Frame = -2 Query: 735 TXASSXSLEXFTNFPTVRSSPSETXRFRCPEALFPTXVLGYGS 607 T ASS S+E P + RFRCPEAL LG S Sbjct: 203 TAASSSSIEKSYELPDGQVITIGNERFRCPEALLQPSFLGMES 245 >SB_13344| Best HMM Match : Actin (HMM E-Value=1.5e-07) Length = 149 Score = 205 bits (500), Expect = 4e-53 Identities = 92/114 (80%), Positives = 103/114 (90%) Frame = -3 Query: 635 FQPSFLGMEACGIHETTYNSVMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALA 456 FQP+FLGMEA GIHE YN +MKCDVDIRKDLY+N VLSGG+TM+PGIADRMQKEI LA Sbjct: 36 FQPAFLGMEAPGIHEAIYNCIMKCDVDIRKDLYSNCVLSGGSTMFPGIADRMQKEIAMLA 95 Query: 455 PSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 294 ++MK+K+IAPPERKYSVWIGGSILASLSTFQQMWI+K+EY E GP IVHRKCF Sbjct: 96 NASMKVKVIAPPERKYSVWIGGSILASLSTFQQMWIAKEEYHEYGPPIVHRKCF 149 Score = 32.3 bits (70), Expect = 0.50 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = -1 Query: 703 YELPDGQVITIGNXKIPLP 647 YELPDGQVI+IGN + P Sbjct: 14 YELPDGQVISIGNERFRCP 32 >SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10) Length = 543 Score = 75.4 bits (177), Expect = 5e-14 Identities = 44/137 (32%), Positives = 69/137 (50%), Gaps = 17/137 (12%) Frame = -3 Query: 641 LXFQPSFLGME-ACGIHETTYNSVMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEIT 465 + F P F + + E N + C +D+R+ LY N VLSGG+TM+ R+Q++I Sbjct: 208 IFFHPEFSNPDFTTPLSEVVDNVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDIK 267 Query: 464 ----------------ALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEY 333 + P ++ ++I+ ++Y+VW GGS+LAS F + +K +Y Sbjct: 268 RTVDARLKMSETLSGGRIKPKPIETQVISHHMQRYAVWFGGSMLASTPEFYSVCHTKADY 327 Query: 332 DESGPSIVHRKCF*THR 282 DE GPSI F HR Sbjct: 328 DEHGPSICRHNPF-LHR 343 >SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07) Length = 240 Score = 69.3 bits (162), Expect = 4e-12 Identities = 31/85 (36%), Positives = 54/85 (63%), Gaps = 3/85 (3%) Frame = -3 Query: 617 GMEACGIHETTYNSVMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKI 438 G A G+ + SV D+DIR L+ + +++GG T+ G +R+ +E+ + P +M++ Sbjct: 146 GSTAMGVTQVVTTSVGMTDIDIRAGLFNSVIVTGGNTLLQGFVERLNRELVSKTPPSMRL 205 Query: 437 KII---APPERKYSVWIGGSILASL 372 K+I + E++++ WIGGSILASL Sbjct: 206 KLISNNSSVEKRFNPWIGGSILASL 230 >SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 411 Score = 68.9 bits (161), Expect = 5e-12 Identities = 45/139 (32%), Positives = 70/139 (50%), Gaps = 29/139 (20%) Frame = -3 Query: 650 AQRLXFQPSFLGMEACGIHETTYNSVMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKE 471 A FQP + +E G+ E +N++ D+D R + Y + VLSGG+TMYPG+ R+++E Sbjct: 261 APEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERE 320 Query: 470 ITAL---------------------APST-----MKIKI-IAPP-ERKYSVWIGGSILAS 375 I L P T K KI I P RK+ V++GG++LA Sbjct: 321 IKQLYLERVLKGDTSKLSSGMGMEQIPLTADYLLQKFKIRIEDPPRRKHMVFMGGAVLAD 380 Query: 374 -LSTFQQMWISKQEYDESG 321 + W++++EY+E G Sbjct: 381 IMKDKDSFWMTRKEYEEKG 399 >SB_54| Best HMM Match : Actin (HMM E-Value=0) Length = 2486 Score = 54.8 bits (126), Expect = 8e-08 Identities = 22/40 (55%), Positives = 30/40 (75%) Frame = -3 Query: 635 FQPSFLGMEACGIHETTYNSVMKCDVDIRKDLYANTVLSG 516 FQPS LG + GIHE+ + S+ KCD+D+R +L+ N VLSG Sbjct: 2307 FQPSLLGRDIDGIHESIFKSIKKCDIDLRAELFHNIVLSG 2346 >SB_22343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 52.0 bits (119), Expect = 6e-07 Identities = 30/94 (31%), Positives = 45/94 (47%), Gaps = 9/94 (9%) Frame = -3 Query: 581 NSVMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPS--------TMKIKIIA 426 +S++ C +D RK L N VL GGT M PG R+ +EI L S +K+ Sbjct: 64 DSLLLCPIDTRKTLAENIVLIGGTAMTPGFKHRLMQEIYLLLQSPKYKDKLFIKTVKMHQ 123 Query: 425 PP-ERKYSVWIGGSILASLSTFQQMWISKQEYDE 327 PP + W+GG+I SL +++ Y + Sbjct: 124 PPVNANITAWLGGAIFGSLEVLADRSTTRERYQQ 157 >SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40) Length = 367 Score = 37.9 bits (84), Expect = 0.010 Identities = 14/28 (50%), Positives = 23/28 (82%) Frame = -3 Query: 578 SVMKCDVDIRKDLYANTVLSGGTTMYPG 495 ++ K D+D+R+ LY+N VLSGG+T++ G Sbjct: 264 AIQKSDLDLRRVLYSNIVLSGGSTLFKG 291 >SB_42882| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 1973 Score = 29.9 bits (64), Expect = 2.7 Identities = 17/62 (27%), Positives = 31/62 (50%), Gaps = 2/62 (3%) Frame = +1 Query: 385 IDPPIHTEYFLSGGAMILIFIVDGARAVISFCIRSAIPGYMV-VPPD-NTVLAYKSLRMS 558 +DPP+ +Y L+GG ++ + FCI G++V PP+ N+ + R++ Sbjct: 758 LDPPLENKYNLNGGQQVIQSTLQIQSLFFPFCI---FQGFVVPTPPECNSAIVLPDARIT 814 Query: 559 TS 564 S Sbjct: 815 AS 816 >SB_5589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 583 Score = 29.1 bits (62), Expect = 4.7 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = -1 Query: 412 STPYGSVDRSSPPSLPSNKCGSRNKSTTSLAPPLYTGSAS 293 STP +V PP PSN+ + +K S +P T S S Sbjct: 217 STPQATVQTPPPPPEPSNEPSTSSKPKASPSPSSITTSTS 256 >SB_50207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 318 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/37 (32%), Positives = 15/37 (40%) Frame = -1 Query: 370 LPSNKCGSRNKSTTSLAPPLYTGSASKRTARRCLQQP 260 L C SR K P Y G RT ++C +P Sbjct: 118 LVKRTCNSRKKKKPEKRPSSYNGDTDYRTRKQCRYEP 154 >SB_38754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 28.3 bits (60), Expect = 8.2 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -3 Query: 533 NTVLSGGTTMYPGIADRMQKEITALAP 453 N ++GG TMY R+++E+ A+ P Sbjct: 132 NVFVTGGNTMYNNFMARLERELLAIRP 158 >SB_9926| Best HMM Match : DPPIV_N (HMM E-Value=0) Length = 1066 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = -1 Query: 367 PSNKCGSRNKSTTSLAPPLYTGSASK--RTARRCLQQPAAGC 248 P N+ G++ + +L P++TGS + RT + P+A C Sbjct: 879 PGNQAGNKTRPLRALRSPIHTGSTLEVDRTRQGTRPDPSARC 920 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,795,961 Number of Sequences: 59808 Number of extensions: 479660 Number of successful extensions: 1346 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 1243 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1343 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2371447782 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -