BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_G16 (832 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X06905-1|CAA30009.1| 489|Tribolium castaneum protein ( Triboliu... 25 0.56 U04271-2|AAA03709.1| 490|Tribolium castaneum alpha-amylase II p... 25 0.56 U04271-1|AAA03708.1| 490|Tribolium castaneum alpha-amylase I pr... 25 0.56 AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory recept... 24 1.3 EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 23 3.9 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 22 5.2 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 22 5.2 >X06905-1|CAA30009.1| 489|Tribolium castaneum protein ( Tribolium castaneum mRNAfor alhpa amylase 3'region. ). Length = 489 Score = 25.4 bits (53), Expect = 0.56 Identities = 13/41 (31%), Positives = 18/41 (43%) Frame = +1 Query: 481 GYGLSTGMLTGNGTAFSTGYGMCFSTGVRGGHWYLDGVRNW 603 G +S TG GT YG+ +GG+ L + NW Sbjct: 246 GEAISKHEYTGFGTVIEFQYGLSLGNAFQGGN-QLANLANW 285 >U04271-2|AAA03709.1| 490|Tribolium castaneum alpha-amylase II protein. Length = 490 Score = 25.4 bits (53), Expect = 0.56 Identities = 13/41 (31%), Positives = 18/41 (43%) Frame = +1 Query: 481 GYGLSTGMLTGNGTAFSTGYGMCFSTGVRGGHWYLDGVRNW 603 G +S TG GT YG+ +GG+ L + NW Sbjct: 247 GEAISKHEYTGFGTVIEFQYGLSLGNAFQGGN-QLANLANW 286 >U04271-1|AAA03708.1| 490|Tribolium castaneum alpha-amylase I protein. Length = 490 Score = 25.4 bits (53), Expect = 0.56 Identities = 13/41 (31%), Positives = 18/41 (43%) Frame = +1 Query: 481 GYGLSTGMLTGNGTAFSTGYGMCFSTGVRGGHWYLDGVRNW 603 G +S TG GT YG+ +GG+ L + NW Sbjct: 247 GEAISKHEYTGFGTVIEFQYGLSLGNAFQGGN-QLANLANW 286 >AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory receptor candidate 5 protein. Length = 522 Score = 24.2 bits (50), Expect = 1.3 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -2 Query: 144 LITFELMYLLWLSYEKLSPIFI 79 +ITF ++ + SYEKLSP+ + Sbjct: 326 VITFLIVMVQKASYEKLSPVVL 347 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 22.6 bits (46), Expect = 3.9 Identities = 12/29 (41%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = +1 Query: 520 TAFSTGYGMCFSTGVRGGHWYLD-GVRNW 603 + S G+ + +ST GHWYLD G W Sbjct: 447 SVLSHGHRVIYSTV---GHWYLDCGFGPW 472 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 22.2 bits (45), Expect = 5.2 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = +3 Query: 408 WYRYLNWVRYG 440 W +L+W RYG Sbjct: 587 WLSFLSWFRYG 597 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 22.2 bits (45), Expect = 5.2 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = +3 Query: 408 WYRYLNWVRYG 440 W +L+W RYG Sbjct: 587 WLSFLSWFRYG 597 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 132,114 Number of Sequences: 336 Number of extensions: 2257 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22829180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -