BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_G16 (832 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g35785.2 68417.m05083 transformer serine/arginine-rich ribonu... 34 0.13 At2g40040.1 68415.m04920 defective chloroplasts and leaves prote... 31 1.2 At4g35785.1 68417.m05082 transformer serine/arginine-rich ribonu... 30 1.6 At3g16460.2 68416.m02097 jacalin lectin family protein contains ... 29 2.9 At3g16460.1 68416.m02098 jacalin lectin family protein contains ... 29 2.9 At5g53870.1 68418.m06701 plastocyanin-like domain-containing pro... 29 3.8 At3g26510.4 68416.m03309 octicosapeptide/Phox/Bem1p (PB1) domain... 29 3.8 At3g26510.3 68416.m03306 octicosapeptide/Phox/Bem1p (PB1) domain... 29 3.8 At3g26510.2 68416.m03307 octicosapeptide/Phox/Bem1p (PB1) domain... 29 3.8 At3g26510.1 68416.m03308 octicosapeptide/Phox/Bem1p (PB1) domain... 29 3.8 At2g28240.1 68415.m03428 hydroxyproline-rich glycoprotein family... 29 3.8 At3g08670.1 68416.m01007 expressed protein 29 5.0 At1g25550.1 68414.m03172 myb family transcription factor contain... 29 5.0 At4g32420.1 68417.m04615 peptidyl-prolyl cis-trans isomerase cyc... 28 6.6 At4g09030.1 68417.m01490 arabinogalactan-protein (AGP10) identic... 28 6.6 At1g47660.1 68414.m05295 hypothetical protein 28 6.6 At4g00890.1 68417.m00120 proline-rich family protein contains pr... 28 8.7 At3g20280.2 68416.m02570 PHD finger family protein contains Pfam... 28 8.7 At3g20280.1 68416.m02569 PHD finger family protein contains Pfam... 28 8.7 >At4g35785.2 68417.m05083 transformer serine/arginine-rich ribonucleoprotein, putative similar to transformer-SR ribonucleoprotein [Nicotiana tabacum] gi|1781299|emb|CAA70700 Length = 141 Score = 33.9 bits (74), Expect = 0.13 Identities = 22/60 (36%), Positives = 33/60 (55%), Gaps = 4/60 (6%) Frame = -1 Query: 658 SPYPVKYTLXAQCPSMSRASSVPRQGTSARPLP----PSRSTSRTQ*KRPCRSQLTSPST 491 SP P K ++ S SR+ S PR + +R LP PSRS R++ + RS++ +P T Sbjct: 13 SPSPRKERARSRSRSRSRSRSRPRLRSRSRSLPRPVSPSRSRGRSRSRSRGRSEVENPGT 72 >At2g40040.1 68415.m04920 defective chloroplasts and leaves protein-related / DCL protein-related similar to DCL protein, chloroplast precursor (Defective chloroplasts and leaves protein) (Swiss-Prot:Q42463) [Lycopersicon esculentum] Length = 839 Score = 30.7 bits (66), Expect = 1.2 Identities = 22/71 (30%), Positives = 37/71 (52%), Gaps = 3/71 (4%) Frame = -1 Query: 628 AQCPSMSRASSVPRQGTSARPLPPSRSTSRTQ*KRPCRSQLTSPSTGHTQSTSRSTCLC- 452 AQ S S+ S + + ++ S+S S++Q + +SQ SPS TQS S++ Sbjct: 768 AQAQSPSQTQSQSQSQSQSQSQSQSQSQSQSQSQSQSQSQSQSPSQTQTQSPSQTQAQAQ 827 Query: 451 --TLRSPYRTQ 425 + +SP +TQ Sbjct: 828 SPSSQSPSQTQ 838 >At4g35785.1 68417.m05082 transformer serine/arginine-rich ribonucleoprotein, putative similar to transformer-SR ribonucleoprotein [Nicotiana tabacum] gi|1781299|emb|CAA70700 Length = 140 Score = 30.3 bits (65), Expect = 1.6 Identities = 22/60 (36%), Positives = 32/60 (53%), Gaps = 4/60 (6%) Frame = -1 Query: 658 SPYPVKYTLXAQCPSMSRASSVPRQGTSARPLP----PSRSTSRTQ*KRPCRSQLTSPST 491 SP P K ++ S SR+ S PR + +R LP PSRS R++ R S++ +P T Sbjct: 13 SPSPRKERARSRSRSRSRSRSRPRLRSRSRSLPRPVSPSRSRGRSR-SRSRGSEVENPGT 71 >At3g16460.2 68416.m02097 jacalin lectin family protein contains Pfam profile: PF01419 jacalin-like lectin domain; similar to myrosinase binding protein [Brassica napus] GI:1711296, GI:1655824, myrosinase-binding protein homolog [Arabidopsis thaliana] GI:2997767; contains Pfam profile PF01419 jacalin-like lectin family Length = 647 Score = 29.5 bits (63), Expect = 2.9 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 454 TGTCFSMWTGYGLSTGMLTGNGTAFSTGYG 543 TGT TG G TG TG GT TG G Sbjct: 138 TGTGTGTGTGTGTGTGTGTGTGTGTGTGTG 167 >At3g16460.1 68416.m02098 jacalin lectin family protein contains Pfam profile: PF01419 jacalin-like lectin domain; similar to myrosinase binding protein [Brassica napus] GI:1711296, GI:1655824, myrosinase-binding protein homolog [Arabidopsis thaliana] GI:2997767; contains Pfam profile PF01419 jacalin-like lectin family Length = 705 Score = 29.5 bits (63), Expect = 2.9 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 454 TGTCFSMWTGYGLSTGMLTGNGTAFSTGYG 543 TGT TG G TG TG GT TG G Sbjct: 138 TGTGTGTGTGTGTGTGTGTGTGTGTGTGTG 167 >At5g53870.1 68418.m06701 plastocyanin-like domain-containing protein contains similarity to SP|Q02917 Early nodulin 55-2 precursor {Glycine max}; PF02298: Plastocyanin-like domain Length = 370 Score = 29.1 bits (62), Expect = 3.8 Identities = 25/97 (25%), Positives = 36/97 (37%), Gaps = 1/97 (1%) Frame = -1 Query: 724 PXQIPNQXXPRREAXPXPGRKTSPYPVKYTLXAQCPSMSRASSVPRQGTSAR-PLPPSRS 548 P P++ P R + S P+ +T A PS + + S S + P P S S Sbjct: 162 PASAPSKSQPPRSSVSPAQPPKSSSPISHT-PALSPSHATSHSPATPSPSPKSPSPVSHS 220 Query: 547 TSRTQ*KRPCRSQLTSPSTGHTQSTSRSTCLCTLRSP 437 S + P S +PS + S S SP Sbjct: 221 PSHSPAHTPSHSPAHTPSHSPAHAPSHSPAHAPSHSP 257 >At3g26510.4 68416.m03309 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein contains Pfam profile PF00564: PB1 domain Length = 196 Score = 29.1 bits (62), Expect = 3.8 Identities = 20/55 (36%), Positives = 26/55 (47%), Gaps = 4/55 (7%) Frame = -1 Query: 670 GRKTSPYPVKY---TLXAQCPSMSRASSVPRQGTSAR-PLPPSRSTSRTQ*KRPC 518 G K SP P+ T + + S SS PR + ++ PLPPS T K PC Sbjct: 120 GSKKSPPPLALPSSTTTSSSSTTSSTSSSPRSPSLSKPPLPPSPPRITTVTKNPC 174 >At3g26510.3 68416.m03306 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein contains Pfam profile PF00564: PB1 domain Length = 218 Score = 29.1 bits (62), Expect = 3.8 Identities = 20/55 (36%), Positives = 26/55 (47%), Gaps = 4/55 (7%) Frame = -1 Query: 670 GRKTSPYPVKY---TLXAQCPSMSRASSVPRQGTSAR-PLPPSRSTSRTQ*KRPC 518 G K SP P+ T + + S SS PR + ++ PLPPS T K PC Sbjct: 142 GSKKSPPPLALPSSTTTSSSSTTSSTSSSPRSPSLSKPPLPPSPPRITTVTKNPC 196 >At3g26510.2 68416.m03307 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein contains Pfam profile PF00564: PB1 domain Length = 196 Score = 29.1 bits (62), Expect = 3.8 Identities = 20/55 (36%), Positives = 26/55 (47%), Gaps = 4/55 (7%) Frame = -1 Query: 670 GRKTSPYPVKY---TLXAQCPSMSRASSVPRQGTSAR-PLPPSRSTSRTQ*KRPC 518 G K SP P+ T + + S SS PR + ++ PLPPS T K PC Sbjct: 120 GSKKSPPPLALPSSTTTSSSSTTSSTSSSPRSPSLSKPPLPPSPPRITTVTKNPC 174 >At3g26510.1 68416.m03308 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein contains Pfam profile PF00564: PB1 domain Length = 196 Score = 29.1 bits (62), Expect = 3.8 Identities = 20/55 (36%), Positives = 26/55 (47%), Gaps = 4/55 (7%) Frame = -1 Query: 670 GRKTSPYPVKY---TLXAQCPSMSRASSVPRQGTSAR-PLPPSRSTSRTQ*KRPC 518 G K SP P+ T + + S SS PR + ++ PLPPS T K PC Sbjct: 120 GSKKSPPPLALPSSTTTSSSSTTSSTSSSPRSPSLSKPPLPPSPPRITTVTKNPC 174 >At2g28240.1 68415.m03428 hydroxyproline-rich glycoprotein family protein Length = 660 Score = 29.1 bits (62), Expect = 3.8 Identities = 21/95 (22%), Positives = 36/95 (37%), Gaps = 1/95 (1%) Frame = -1 Query: 751 P*GSMGQXYPXQIPNQXXPRREAXPXPGRKT-SPYPVKYTLXAQCPSMSRASSVPRQGTS 575 P S P + P + P P T P P+ + + +++++PR + Sbjct: 341 PMNSTAPPRPSVTAAEATPPNLSAPLPHCNTPQPSPISQQAAVESNTQMQSTALPRPSVT 400 Query: 574 ARPLPPSRSTSRTQ*KRPCRSQLTSPSTGHTQSTS 470 A P + S T RP Q + S + ST+ Sbjct: 401 AEARPLHQPHSNTSQPRPIPQQALAQSNTNITSTA 435 >At3g08670.1 68416.m01007 expressed protein Length = 567 Score = 28.7 bits (61), Expect = 5.0 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Frame = -1 Query: 658 SPYPVKYTLXAQCPSMSRASSVP-RQGTSARPLPPSRSTSRTQ*KRPCRSQLTSPST 491 SP + T A S R SS R +SARP P+R++S ++ P R + S S+ Sbjct: 175 SPSSILNTSSASVSSYIRPSSPSSRSSSSARPSTPTRTSSASRSSTPSRIRPGSSSS 231 >At1g25550.1 68414.m03172 myb family transcription factor contains Pfam domain, PF00249: Myb-like DNA-binding domain Length = 344 Score = 28.7 bits (61), Expect = 5.0 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = -1 Query: 562 PPSRSTSRTQ*KRPCRSQLTSPSTGHT 482 PP STS + R C+S TS +T HT Sbjct: 311 PPQSSTSGERSNRGCKSPATSSTTTHT 337 >At4g32420.1 68417.m04615 peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein weak similarity to CARS-Cyp [Homo sapiens] GI:1117968; contains Pfam profile PF00160: peptidyl-prolyl cis-trans isomerase, cyclophilin-type Length = 837 Score = 28.3 bits (60), Expect = 6.6 Identities = 30/111 (27%), Positives = 47/111 (42%), Gaps = 2/111 (1%) Frame = -1 Query: 745 GSMGQXYPXQIPNQXXPRREAXPXPGRKTSPYPVKYTLXAQCPSMSRAS--SVPRQGTSA 572 GS+G+ P + ++ P R R S P++ + + S +R S S+ R + Sbjct: 508 GSLGRG-PLRRSSRRSPSRSPVRSSRRSLSRSPIQLSRRSLSRSPTRLSRRSLSRSPIRS 566 Query: 571 RPLPPSRSTSRTQ*KRPCRSQLTSPSTGHTQSTSRSTCLCTLRSPYRTQLR 419 SRS R+ K RS + S ++S RS+ RSP R R Sbjct: 567 PRKSVSRSPVRSSRKSVSRSPVRSSRRRISRSPVRSSRKSVSRSPIRLSRR 617 >At4g09030.1 68417.m01490 arabinogalactan-protein (AGP10) identical to gi|10880497|gb|AAG24278; supported by Ceres cDNA 265772 Length = 127 Score = 28.3 bits (60), Expect = 6.6 Identities = 16/57 (28%), Positives = 23/57 (40%) Frame = -1 Query: 715 IPNQXXPRREAXPXPGRKTSPYPVKYTLXAQCPSMSRASSVPRQGTSARPLPPSRST 545 +P+ P R A P P +P P P A S P +++ P PP+ T Sbjct: 33 LPSPAQPPRTAAPTPSITPTPTPTPSATPTAAPVSPPAGS-PLPSSASPPAPPTSLT 88 >At1g47660.1 68414.m05295 hypothetical protein Length = 275 Score = 28.3 bits (60), Expect = 6.6 Identities = 28/88 (31%), Positives = 35/88 (39%), Gaps = 6/88 (6%) Frame = -1 Query: 712 PNQXXPRREAXPXPGRKTSPYPVKYTL--XAQCPSMSRAS---SVPRQGTSARPLPPSRS 548 P P R P P R T+P PV T A P A+ +VP A P + Sbjct: 26 PRAAPPARPTTPPPARPTTPPPVWPTTPPPAGAPVAVPAAAHVAVPAAAPVAAPAELGET 85 Query: 547 TS-RTQ*KRPCRSQLTSPSTGHTQSTSR 467 TS RT RS L +T++T R Sbjct: 86 TSRRTNLDEVIRSFLDRLDLQNTRTTER 113 >At4g00890.1 68417.m00120 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 431 Score = 27.9 bits (59), Expect = 8.7 Identities = 16/53 (30%), Positives = 24/53 (45%) Frame = -1 Query: 655 PYPVKYTLXAQCPSMSRASSVPRQGTSARPLPPSRSTSRTQ*KRPCRSQLTSP 497 P P + PSM ++ + PL PS+S T+ + P SQ +SP Sbjct: 175 PPPQEAKTPPSSPSMMLNATEEFESQPKPPLLPSKSIDETRLRSPLMSQASSP 227 >At3g20280.2 68416.m02570 PHD finger family protein contains Pfam profile: PF00628 PHD-finger Length = 482 Score = 27.9 bits (59), Expect = 8.7 Identities = 21/78 (26%), Positives = 33/78 (42%) Frame = -1 Query: 658 SPYPVKYTLXAQCPSMSRASSVPRQGTSARPLPPSRSTSRTQ*KRPCRSQLTSPSTGHTQ 479 SP PV T ++ SV G ++PL P + S T P +QL +T + Sbjct: 205 SPAPVSLTETPNRTGIASTISVINNGLISKPLTPVGTMSSTS-PLPVVNQLPVNATSNAS 263 Query: 478 STSRSTCLCTLRSPYRTQ 425 ++ T ++P TQ Sbjct: 264 PSTPITASLVAQAPTVTQ 281 >At3g20280.1 68416.m02569 PHD finger family protein contains Pfam profile: PF00628 PHD-finger Length = 743 Score = 27.9 bits (59), Expect = 8.7 Identities = 21/78 (26%), Positives = 33/78 (42%) Frame = -1 Query: 658 SPYPVKYTLXAQCPSMSRASSVPRQGTSARPLPPSRSTSRTQ*KRPCRSQLTSPSTGHTQ 479 SP PV T ++ SV G ++PL P + S T P +QL +T + Sbjct: 466 SPAPVSLTETPNRTGIASTISVINNGLISKPLTPVGTMSSTS-PLPVVNQLPVNATSNAS 524 Query: 478 STSRSTCLCTLRSPYRTQ 425 ++ T ++P TQ Sbjct: 525 PSTPITASLVAQAPTVTQ 542 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,980,649 Number of Sequences: 28952 Number of extensions: 199010 Number of successful extensions: 742 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 564 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 708 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1911862400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -