BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_G12 (844 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81518-1|CAB04214.3| 601|Caenorhabditis elegans Hypothetical pr... 28 7.2 M86959-1|AAD03339.1| 852|Caenorhabditis elegans elongation fact... 28 9.5 >Z81518-1|CAB04214.3| 601|Caenorhabditis elegans Hypothetical protein F28D9.1 protein. Length = 601 Score = 28.3 bits (60), Expect = 7.2 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = -1 Query: 427 RARPSATR-PPLAVRRSLGDRARRSSLGASVPPSRRRDS 314 R PSA++ PP RR ++R + +PP+RRR S Sbjct: 376 RRSPSASKSPPAPRRRRSPSKSRSPAPKREIPPARRRRS 414 >M86959-1|AAD03339.1| 852|Caenorhabditis elegans elongation factor protein. Length = 852 Score = 27.9 bits (59), Expect = 9.5 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +3 Query: 261 SPNRHCTLVDTLHVPPPQLSRRRDGGTLAPSDDRRARS 374 SPN+H L T P L+ +GGT++ D+ +AR+ Sbjct: 589 SPNKHNRLHCTAQPMPDGLADDIEGGTVSARDEFKARA 626 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,828,389 Number of Sequences: 27780 Number of extensions: 214218 Number of successful extensions: 659 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 578 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 648 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2087513582 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -