BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_G06 (857 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 25 1.0 AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless pr... 25 1.0 AY321476-2|AAQ23387.1| 257|Tribolium castaneum Ase protein. 22 5.4 AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment h... 22 7.1 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 9.4 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 21 9.4 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 24.6 bits (51), Expect = 1.0 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -2 Query: 355 QADHPRQVQRHHQVAGFQPAGRQG 284 Q HP+ Q HHQ G+QG Sbjct: 172 QEQHPQHHQPHHQQQHMMYGGQQG 195 >AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless protein. Length = 325 Score = 24.6 bits (51), Expect = 1.0 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -2 Query: 355 QADHPRQVQRHHQVAGFQPAGRQG 284 Q HP+ Q HHQ G+QG Sbjct: 174 QEQHPQHHQPHHQQQHMMYGGQQG 197 >AY321476-2|AAQ23387.1| 257|Tribolium castaneum Ase protein. Length = 257 Score = 22.2 bits (45), Expect = 5.4 Identities = 6/15 (40%), Positives = 11/15 (73%) Frame = +3 Query: 102 LIDLLXWWGQRLQPR 146 ++D++ WW Q+ PR Sbjct: 239 VMDVMQWWEQQQTPR 253 >AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment homeodomain protein protein. Length = 232 Score = 21.8 bits (44), Expect = 7.1 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = -3 Query: 411 SMKSTMEDEKLKEKISDSD 355 S+ S EDE+++ ++SD D Sbjct: 18 SLLSKKEDEEVEHRLSDRD 36 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.4 bits (43), Expect = 9.4 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = +3 Query: 204 LLRHPGTSS*LSDCKCLPILSACAHTPPCRPAGWNP 311 +L+ P T D K LP H PP P G NP Sbjct: 720 MLQSPLTPHEAFDVK-LPPPPHPHHQPPRNPVGTNP 754 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.4 bits (43), Expect = 9.4 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = +3 Query: 204 LLRHPGTSS*LSDCKCLPILSACAHTPPCRPAGWNP 311 +L+ P T D K LP H PP P G NP Sbjct: 612 MLQSPLTPHEAFDVK-LPPPPHPHHQPPRNPVGTNP 646 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 161,099 Number of Sequences: 336 Number of extensions: 3359 Number of successful extensions: 10 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23763101 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -