BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_G04 (889 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U13646-1|AAC24418.2| 2585|Caenorhabditis elegans Hypothetical pr... 29 4.4 >U13646-1|AAC24418.2| 2585|Caenorhabditis elegans Hypothetical protein ZK783.1 protein. Length = 2585 Score = 29.1 bits (62), Expect = 4.4 Identities = 19/71 (26%), Positives = 28/71 (39%), Gaps = 2/71 (2%) Frame = +2 Query: 68 SRQTSQVEV*TLKRNDKGRECEFGGRSRGGGAANPTTHVVTDRSPCRRAGGAGNCRPPLT 247 S EV T+ + + +EC GG + G V +++PC N + Sbjct: 1551 SESNMSCEVDTVDGSVECKEC-MGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFS 1609 Query: 248 CS--GGYRKRG 274 CS GYR G Sbjct: 1610 CSCKQGYRGDG 1620 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,865,441 Number of Sequences: 27780 Number of extensions: 226544 Number of successful extensions: 499 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 429 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 486 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2244863852 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -