BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_F22 (790 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49893| Best HMM Match : ATP-synt_ab (HMM E-Value=0) 173 1e-43 SB_55653| Best HMM Match : No HMM Matches (HMM E-Value=.) 94 1e-19 SB_42081| Best HMM Match : ATP-synt_ab (HMM E-Value=8.3e-07) 83 3e-16 SB_58524| Best HMM Match : Ank (HMM E-Value=3.4e-16) 31 1.4 SB_21210| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_47849| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_13369| Best HMM Match : UPF0005 (HMM E-Value=0.3) 29 3.2 SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) 29 4.3 SB_47328| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_32511| Best HMM Match : DUF885 (HMM E-Value=8.6e-15) 29 4.3 SB_17274| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_52217| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.7 SB_11423| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.7 SB_54674| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.7 SB_21412| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_19450| Best HMM Match : GTP_EFTU (HMM E-Value=7.9e-08) 28 7.5 SB_9194| Best HMM Match : SWIM (HMM E-Value=0.01) 28 7.5 SB_41873| Best HMM Match : Homeobox (HMM E-Value=2.3e-29) 28 9.9 >SB_49893| Best HMM Match : ATP-synt_ab (HMM E-Value=0) Length = 313 Score = 173 bits (422), Expect = 1e-43 Identities = 85/172 (49%), Positives = 114/172 (66%) Frame = -2 Query: 783 IPTXVISITDGQXFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGSMKLELAQY 604 +PT VISITDGQ FLE+ +F GIRPA+N G+SVSRVG AAQTK +K+++G ++ LAQY Sbjct: 141 VPTNVISITDGQIFLESAMFNSGIRPAVNAGISVSRVGGAAQTKIIKKLSGGIRTALAQY 200 Query: 603 REVAAFAQFGSDLDAATQQLLNRGMRLTELLKQGQYVPMAIEEQVAIIYCGVRGHLDKLD 424 RE+AAFAQF SDLD AT++ L G R+TEL+KQ QY PM+I + +Y RG L ++ Sbjct: 201 RELAAFAQFASDLDEATRKQLEHGQRVTELMKQKQYAPMSIADMSVSLYAAERGFLVDIE 260 Query: 423 PSKITAFEKEFTQHIKTSHQGLLSTIAKDGQITPESDASLKKIVTDFLATFT 268 +K+ AFE+ + H LL+ I + G + D LK + F AT T Sbjct: 261 VAKVGAFEQALIAYFNRDHAALLAKINEKGDFNDDIDGQLKAGIEKFKATQT 312 >SB_55653| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 390 Score = 93.9 bits (223), Expect = 1e-19 Identities = 46/50 (92%), Positives = 47/50 (94%) Frame = -2 Query: 783 IPTXVISITDGQXFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVA 634 IPT VISITDGQ FLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQ + Sbjct: 287 IPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQTS 336 >SB_42081| Best HMM Match : ATP-synt_ab (HMM E-Value=8.3e-07) Length = 99 Score = 82.6 bits (195), Expect = 3e-16 Identities = 40/50 (80%), Positives = 44/50 (88%) Frame = -2 Query: 783 IPTXVISITDGQXFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVA 634 IPT VISITDGQ FL++ELFY GIRPAINVGLSVSRVGSAAQ MK++A Sbjct: 49 IPTNVISITDGQIFLDSELFYNGIRPAINVGLSVSRVGSAAQVAMMKKLA 98 >SB_58524| Best HMM Match : Ank (HMM E-Value=3.4e-16) Length = 1003 Score = 30.7 bits (66), Expect = 1.4 Identities = 23/66 (34%), Positives = 33/66 (50%) Frame = +1 Query: 157 QQYFRQAKLLI*YGTALQTRVLRSVTRQVT*TSLLRLGESS*EVCDDLLQGGVRLGGDLT 336 ++ FRQAKLL+ G L +R + + SL+ + S +VC LLQ G D+ Sbjct: 10 ERRFRQAKLLVQLGDDLNSRSKETGRSPLVQASLIEDEDLSYKVCHWLLQE----GADIA 65 Query: 337 VFGDRG 354 V D G Sbjct: 66 VRDDHG 71 >SB_21210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 428 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/46 (36%), Positives = 27/46 (58%) Frame = -2 Query: 783 IPTXVISITDGQXFLETELFYKGIRPAINVGLSVSRVGSAAQTKAM 646 IP IT+GQ +++ +L + I P INV S+SR+ +A + M Sbjct: 283 IPDLTGYITEGQIYVDRQLHNRQIYPPINVLPSLSRLMKSAIGEGM 328 >SB_47849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1922 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/45 (33%), Positives = 26/45 (57%) Frame = -2 Query: 405 FEKEFTQHIKTSHQGLLSTIAKDGQITPESDASLKKIVTDFLATF 271 F ++ T+ S+QG + I+ G PESD++ +IV + AT+ Sbjct: 952 FARKLTEEEVKSYQGPVHYISHHGLARPESDSTPLRIVFNMSATY 996 >SB_13369| Best HMM Match : UPF0005 (HMM E-Value=0.3) Length = 509 Score = 29.5 bits (63), Expect = 3.2 Identities = 23/70 (32%), Positives = 32/70 (45%), Gaps = 2/70 (2%) Frame = -1 Query: 469 RHHLLRCPRSPRQAGPLQNH-CLREGIHSTHQN*PPGSSLHDR-QRRSDHPRV*RLLEED 296 RH PR P ++H C R + + H+ P LH R S+H R+ R L + Sbjct: 230 RHLHCHRPRLSNHHRPSRHHHCHRPRLSNHHR---PSRHLHCHCPRLSNHHRLSRHLHSN 286 Query: 295 RHRLPSYFHP 266 R RL + HP Sbjct: 287 RLRLSIHHHP 296 >SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) Length = 5087 Score = 29.1 bits (62), Expect = 4.3 Identities = 17/48 (35%), Positives = 26/48 (54%) Frame = -2 Query: 696 VGLSVSRVGSAAQTKAMKQVAGSMKLELAQYREVAAFAQFGSDLDAAT 553 +G+S R + + K+V S + E+A+ EV AFA S+ D AT Sbjct: 1770 LGISEEREQETEELEEHKEVVESEETEMAEEEEVPAFADIPSE-DTAT 1816 >SB_47328| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1634 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/45 (33%), Positives = 26/45 (57%) Frame = -2 Query: 405 FEKEFTQHIKTSHQGLLSTIAKDGQITPESDASLKKIVTDFLATF 271 F ++ T+ S+QG + I+ G PESD++ +IV + AT+ Sbjct: 620 FARKLTEEEVKSYQGPVHYISHHGVARPESDSTPLRIVFNTSATY 664 >SB_32511| Best HMM Match : DUF885 (HMM E-Value=8.6e-15) Length = 510 Score = 29.1 bits (62), Expect = 4.3 Identities = 11/55 (20%), Positives = 25/55 (45%) Frame = +3 Query: 33 IYYCYITAPTRDKYIP*LYQHSIQPI*MLYYYSSHESTVDITAVLPSGEAFNLIW 197 +++ Y+ ++ +P + + + Y Y++ + T LP+GE N W Sbjct: 34 VFFSYLATEYKEHCVPSGISSGLATLPLSYVYTNGTPGIKTTKTLPTGEVLNGTW 88 >SB_17274| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/45 (33%), Positives = 26/45 (57%) Frame = -2 Query: 405 FEKEFTQHIKTSHQGLLSTIAKDGQITPESDASLKKIVTDFLATF 271 F ++ T+ S+QG + I+ G PESD++ +IV + AT+ Sbjct: 3 FARKLTEEEVKSYQGPVHYISHHGVARPESDSTPLRIVFNTSATY 47 >SB_52217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 28.7 bits (61), Expect = 5.7 Identities = 18/50 (36%), Positives = 26/50 (52%) Frame = -2 Query: 441 HLDKLDPSKITAFEKEFTQHIKTSHQGLLSTIAKDGQITPESDASLKKIV 292 H D L SKI A E FTQ + ++ + + K G ESD+ ++IV Sbjct: 30 HFDALQ-SKIAAMELRFTQREEDLNRIINTAQIKSGMEKEESDSRWRQIV 78 >SB_11423| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 358 Score = 28.7 bits (61), Expect = 5.7 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +3 Query: 129 SSHESTVDITAVLPSGEAFNLIWDCSTNSSFEISHTSSYVN 251 ++H+S D T V SG ++ T S+ ++ TSSYVN Sbjct: 309 AAHQSVEDSTGVQQSGLGNHI--GAHTGDSYHLTQTSSYVN 347 >SB_54674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1149 Score = 28.7 bits (61), Expect = 5.7 Identities = 18/50 (36%), Positives = 26/50 (52%) Frame = -2 Query: 441 HLDKLDPSKITAFEKEFTQHIKTSHQGLLSTIAKDGQITPESDASLKKIV 292 H D L SKI A E FTQ + ++ + + K G ESD+ ++IV Sbjct: 1061 HFDALQ-SKIAAMELRFTQREEDLNRIINTAQIKSGMEKEESDSRWRQIV 1109 >SB_21412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1015 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +3 Query: 564 PSQNRTGQKLRPHGTEPIPASWNRPPAS 647 P+Q R+GQ R G P+PAS +RP S Sbjct: 953 PAQ-RSGQGKRDQGNAPVPASRSRPVPS 979 >SB_19450| Best HMM Match : GTP_EFTU (HMM E-Value=7.9e-08) Length = 926 Score = 28.3 bits (60), Expect = 7.5 Identities = 27/92 (29%), Positives = 43/92 (46%), Gaps = 9/92 (9%) Frame = +1 Query: 343 GDRGEKTLVASFDVLSEFLLEGSDFGGVQLVEVTADTAVNDGDLFLN----SHGHILSLL 510 GD GE + DV+ E +++ +L+EV AD GDLFL S I++ + Sbjct: 696 GDNGE---IVREDVIPEDMVDECRKRRQELIEVVADVDPELGDLFLEEVKPSESQIIAAI 752 Query: 511 EE--LSKTHSSV---EQLLCSGIQVRTELGKS 591 + +T + V L G+QV ++ KS Sbjct: 753 RRATIERTFTPVFVGSALKNKGVQVPHQIDKS 784 >SB_9194| Best HMM Match : SWIM (HMM E-Value=0.01) Length = 701 Score = 28.3 bits (60), Expect = 7.5 Identities = 21/73 (28%), Positives = 33/73 (45%) Frame = +2 Query: 527 RIPLLSSCCVAASKSEPNWAKAATSRY*ANSSFMEPATCFIALV*AADPTRDTDRPTLMA 706 R+P C V SKSE W + + N C + +AD ++T+R TL Sbjct: 470 RLPCKHICAVFLSKSEWGWERLSPLCT-QNPLLSLDELCISSSPPSAD-CKNTERVTLYR 527 Query: 707 GRIPL*NSSVSKK 745 R+P + +S+K Sbjct: 528 ARVPRQKTLISEK 540 >SB_41873| Best HMM Match : Homeobox (HMM E-Value=2.3e-29) Length = 651 Score = 27.9 bits (59), Expect = 9.9 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 597 PHGTEPIPASWNRPPAS*PWSEQQI 671 P G++P+ +SWN P PW Q + Sbjct: 452 PRGSQPLQSSWNPP----PWPRQNV 472 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,206,522 Number of Sequences: 59808 Number of extensions: 467237 Number of successful extensions: 1189 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 1107 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1188 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2167838629 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -