BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_F22 (790 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g07698.1 68415.m00949 ATP synthase alpha chain, mitochondrial... 197 6e-51 At1g50730.1 68414.m05705 expressed protein 31 0.66 At4g38510.2 68417.m05447 vacuolar ATP synthase subunit B, putati... 29 2.7 At4g38510.1 68417.m05446 vacuolar ATP synthase subunit B, putati... 29 2.7 At3g12360.1 68416.m01541 ankyrin repeat family protein contains ... 29 2.7 At1g76030.1 68414.m08827 vacuolar ATP synthase subunit B / V-ATP... 29 2.7 At1g20260.2 68414.m02530 vacuolar ATP synthase subunit B, putati... 29 2.7 At1g79010.1 68414.m09213 NADH-ubiquinone oxidoreductase 23 kDa s... 28 6.1 At1g16700.1 68414.m02000 NADH-ubiquinone oxidoreductase 23 kDa s... 28 6.1 At3g03300.1 68416.m00327 DEAD/DEAH box helicase carpel factory-r... 28 8.1 At2g37050.1 68415.m04546 leucine-rich repeat family protein / pr... 28 8.1 At1g31390.1 68414.m03843 meprin and TRAF homology domain-contain... 28 8.1 >At2g07698.1 68415.m00949 ATP synthase alpha chain, mitochondrial, putative very strong similarity to SP|P23413 ATP synthase alpha chain, mitochondrial (EC 3.6.3.14) {Brassica campestris}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 777 Score = 197 bits (481), Expect = 6e-51 Identities = 104/163 (63%), Positives = 121/163 (74%), Gaps = 1/163 (0%) Frame = -2 Query: 783 IPTXVISITDGQXFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGSMKLELAQY 604 IPT VISITDGQ LETELFY+GIRPAINVGLSVSRVGSAAQ KAMKQV GS KLELAQY Sbjct: 611 IPTNVISITDGQICLETELFYRGIRPAINVGLSVSRVGSAAQLKAMKQVCGSSKLELAQY 670 Query: 603 REVAAFAQFGSDLDAATQQLLNRGMRLTELLKQGQYVPMAIEEQVAIIYCGVRGHLDKLD 424 REVAAFAQFGSDLDAATQ LLNRG RLTE+ KQ QY P+ IE+Q+ +IY V G D++ Sbjct: 671 REVAAFAQFGSDLDAATQALLNRGARLTEVPKQPQYAPLPIEKQILVIYAAVNGFCDRMP 730 Query: 423 PSKITAFEKEFTQHIKTS-HQGLLSTIAKDGQITPESDASLKK 298 +I+ +EK +K Q L + + ++ P DA LK+ Sbjct: 731 LDRISQYEKAIPNSVKPELLQALKGGLTNERKMEP--DAFLKE 771 >At1g50730.1 68414.m05705 expressed protein Length = 1013 Score = 31.5 bits (68), Expect = 0.66 Identities = 28/107 (26%), Positives = 49/107 (45%), Gaps = 5/107 (4%) Frame = -2 Query: 564 DAATQQLLNR---GMRLTELLKQGQYVPMAIEE--QVAIIYCGVRGHLDKLDPSKITAFE 400 D + Q+LN G RL+E Q ++ I+E Q A Y + +L +D + Sbjct: 448 DCSFSQVLNYRLLGNRLSEGKSQEGFLSSLIDEVIQAASQYQSLYDYLRIMDAYVDLMLQ 507 Query: 399 KEFTQHIKTSHQGLLSTIAKDGQITPESDASLKKIVTDFLATFTQSQ 259 + H+ ++S +A+D ++ E ASL+ I+ L+ F Q Sbjct: 508 NKMENHLDALLDDIVS-LARDKFLSEEEQASLQSIILKLLSHFENLQ 553 >At4g38510.2 68417.m05447 vacuolar ATP synthase subunit B, putative / V-ATPase B subunit, putative / vacuolar proton pump B subunit, putative / V-ATPase 57 kDa subunit, putative very strong similarity to SP|P11574 Vacuolar ATP synthase subunit B (EC 3.6.3.14) (V-ATPase B subunit) (Vacuolar proton pump B subunit) (V-ATPase 57 kDa subunit) {Arabidopsis thaliana}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 487 Score = 29.5 bits (63), Expect = 2.7 Identities = 15/39 (38%), Positives = 25/39 (64%) Frame = -2 Query: 762 ITDGQXFLETELFYKGIRPAINVGLSVSRVGSAAQTKAM 646 IT+GQ +++ +L + I P INV S+SR+ +A + M Sbjct: 349 ITEGQIYIDRQLHNRQIYPPINVLPSLSRLMKSAIGEGM 387 >At4g38510.1 68417.m05446 vacuolar ATP synthase subunit B, putative / V-ATPase B subunit, putative / vacuolar proton pump B subunit, putative / V-ATPase 57 kDa subunit, putative very strong similarity to SP|P11574 Vacuolar ATP synthase subunit B (EC 3.6.3.14) (V-ATPase B subunit) (Vacuolar proton pump B subunit) (V-ATPase 57 kDa subunit) {Arabidopsis thaliana}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 487 Score = 29.5 bits (63), Expect = 2.7 Identities = 15/39 (38%), Positives = 25/39 (64%) Frame = -2 Query: 762 ITDGQXFLETELFYKGIRPAINVGLSVSRVGSAAQTKAM 646 IT+GQ +++ +L + I P INV S+SR+ +A + M Sbjct: 349 ITEGQIYIDRQLHNRQIYPPINVLPSLSRLMKSAIGEGM 387 >At3g12360.1 68416.m01541 ankyrin repeat family protein contains ankyrin repeat domains, Pfam:PF00023 Length = 590 Score = 29.5 bits (63), Expect = 2.7 Identities = 26/98 (26%), Positives = 47/98 (47%), Gaps = 6/98 (6%) Frame = -2 Query: 708 PAINVGLSVSRVGSAAQTKAMKQVAG---SMKLELAQYR-EVAAFAQFGSDLDAATQQLL 541 PA+ + S R+ A + K +KQV G +L LA R ++AA Q D+++ + +L Sbjct: 46 PALVLSNSGKRMDQAGKKKYVKQVTGRHNDTELHLAAQRGDLAAVQQILKDINSQMEGIL 105 Query: 540 NRGMRLTELLKQGQYVPMAIEE--QVAIIYCGVRGHLD 433 + E+ + + + E + A+ +GHLD Sbjct: 106 SGEEFDAEVAEIRASIVNEVNELGETALFTAADKGHLD 143 >At1g76030.1 68414.m08827 vacuolar ATP synthase subunit B / V-ATPase B subunit / vacuolar proton pump B subunit / V-ATPase 57 kDa subunit identical to SP|P11574 Vacuolar ATP synthase subunit B (EC 3.6.3.14) (V-ATPase B subunit) (Vacuolar proton pump B subunit) (V-ATPase 57 kDa subunit) {Arabidopsis thaliana} Length = 486 Score = 29.5 bits (63), Expect = 2.7 Identities = 15/39 (38%), Positives = 25/39 (64%) Frame = -2 Query: 762 ITDGQXFLETELFYKGIRPAINVGLSVSRVGSAAQTKAM 646 IT+GQ +++ +L + I P INV S+SR+ +A + M Sbjct: 348 ITEGQIYIDRQLHNRQIYPPINVLPSLSRLMKSAIGEGM 386 >At1g20260.2 68414.m02530 vacuolar ATP synthase subunit B, putative / V-ATPase B subunit, putative / vacuolar proton pump B subunit, putative / V-ATPase 57 kDa subunit, putative strong similarity to SP|P11574 Vacuolar ATP synthase subunit B (EC 3.6.3.14) (V-ATPase B subunit) (Vacuolar proton pump B subunit) (V-ATPase 57 kDa subunit) {Arabidopsis thaliana}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 485 Score = 29.5 bits (63), Expect = 2.7 Identities = 15/39 (38%), Positives = 25/39 (64%) Frame = -2 Query: 762 ITDGQXFLETELFYKGIRPAINVGLSVSRVGSAAQTKAM 646 IT+GQ +++ +L + I P INV S+SR+ +A + M Sbjct: 347 ITEGQIYIDRQLHNRQIYPPINVLPSLSRLMKSAIGEGM 385 >At1g79010.1 68414.m09213 NADH-ubiquinone oxidoreductase 23 kDa subunit, mitochondrial (TYKY) identical to SP|Q42599 NADH-ubiquinone oxidoreductase 23 kDa subunit, mitochondrial precursor (EC 1.6.5.3) (EC 1.6.99.3) (Complex I-23KD) (CI-23KD) (Complex I- 28.5KD) (CI-28.5KD) {Arabidopsis thaliana} Length = 222 Score = 28.3 bits (60), Expect = 6.1 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -1 Query: 724 LQRYPTSHQRRSVCIACRIC 665 L+RYPT +R CIAC++C Sbjct: 113 LRRYPTGEER---CIACKLC 129 >At1g16700.1 68414.m02000 NADH-ubiquinone oxidoreductase 23 kDa subunit, mitochondrial, putative very strong similarity to SP|Q42599 NADH-ubiquinone oxidoreductase 23 kDa subunit, mitochondrial precursor (EC 1.6.5.3) (EC 1.6.99.3) (Complex I-23KD) (CI-23KD) (Complex I- 28.5KD) (CI-28.5KD) {Arabidopsis thaliana}; contains Pfam profile PF00037: iron-sulfur cluster-binding protein Length = 222 Score = 28.3 bits (60), Expect = 6.1 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -1 Query: 724 LQRYPTSHQRRSVCIACRIC 665 L+RYPT +R CIAC++C Sbjct: 113 LRRYPTGEER---CIACKLC 129 >At3g03300.1 68416.m00327 DEAD/DEAH box helicase carpel factory-related similar to RNA helicase GB:AAF03534 Length = 1317 Score = 27.9 bits (59), Expect = 8.1 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -2 Query: 399 KEFTQHIKTSHQGLLSTIAKDGQIT 325 ++ QH T H+GLLST KDG I+ Sbjct: 940 QQLFQHCHTHHEGLLST-KKDGMIS 963 >At2g37050.1 68415.m04546 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 934 Score = 27.9 bits (59), Expect = 8.1 Identities = 26/82 (31%), Positives = 41/82 (50%), Gaps = 6/82 (7%) Frame = -2 Query: 777 TXVISITDGQXFLET-ELFYKGIRPAINVGLSVSRVGSA-AQTKAMKQVAGSMKLELAQ- 607 T VIS T +ET EL + P ++V LS + G T ++Q++GSM + Sbjct: 128 TIVISET---YIIETAELVFLASSPTVSVCLSNATTGQPFISTLELRQLSGSMYGSMLSE 184 Query: 606 ---YREVAAFAQFGSDLDAATQ 550 Y VAA FG++ +A+ + Sbjct: 185 DRFYLSVAARINFGAESEASVR 206 >At1g31390.1 68414.m03843 meprin and TRAF homology domain-containing protein / MATH domain-containing protein similar to ubiquitin-specific protease 12 [Arabidopsis thaliana] GI:11993471; contains Pfam profile PF00917: MATH domain Length = 268 Score = 27.9 bits (59), Expect = 8.1 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Frame = +1 Query: 307 GGVRLGGDLTVFGDRGEKTLVASFDVLSEFLL--EGSDFGGVQLVEVTADTAVN 462 GG + GD+ + + G +V DVL E LL E D G Q++ ++ N Sbjct: 120 GGFLVNGDVKIVVEVGVLEVVGKSDVLEETLLVHESIDINGFQVLPSQVESVNN 173 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,004,320 Number of Sequences: 28952 Number of extensions: 313159 Number of successful extensions: 884 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 850 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 884 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1775300800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -