BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_F20 (803 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 pr... 27 0.90 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 25 2.7 M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles ... 24 4.8 >AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 protein. Length = 507 Score = 26.6 bits (56), Expect = 0.90 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +3 Query: 429 CFPLDRYNTHKLRSHISLFFTLHSSF 506 CFP R H L H+ F + H+S+ Sbjct: 33 CFPYTRQKPHLLYGHMEQFQSKHASY 58 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 25.0 bits (52), Expect = 2.7 Identities = 13/38 (34%), Positives = 20/38 (52%), Gaps = 3/38 (7%) Frame = +1 Query: 184 LAIFIKMFIISL---PKGLKCYHTFVPRTLKAMRDETV 288 L I ++ F++SL P CY T +P T+ + TV Sbjct: 932 LNIHVRFFMLSLENKPHVFDCYTTVIPHTVLTQYNYTV 969 >M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 442 Score = 24.2 bits (50), Expect = 4.8 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +2 Query: 509 TNTHADLSWKVLNHNSTPTTLPFLVWRY 592 TNT + S VLNH++T T + VW Y Sbjct: 231 TNTKSS-SDPVLNHDTTNTGIAEKVWLY 257 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 770,676 Number of Sequences: 2352 Number of extensions: 16451 Number of successful extensions: 21 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 84823812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -