BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_F19 (764 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 23 3.5 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 23 3.5 AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory recept... 23 3.5 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 22 4.7 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 21 8.2 AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory recept... 21 8.2 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 22.6 bits (46), Expect = 3.5 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +1 Query: 85 NLF*QKSNELLFIYTHNSRSNVYNFINS 168 N + ++ N+L +Y +VY+FIN+ Sbjct: 349 NTYNEQGNKLADLYKSLGPDSVYSFINN 376 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 22.6 bits (46), Expect = 3.5 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +1 Query: 85 NLF*QKSNELLFIYTHNSRSNVYNFINS 168 N + ++ N+L +Y +VY+FIN+ Sbjct: 241 NTYNEQGNKLADLYKSLGPDSVYSFINN 268 >AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory receptor candidate 41 protein. Length = 398 Score = 22.6 bits (46), Expect = 3.5 Identities = 9/36 (25%), Positives = 17/36 (47%) Frame = +1 Query: 148 VYNFINSTRNISLFGKLLIKNCVKCLRVNQFIFGVC 255 V F+ + I +FG ++ K C+ + Q +C Sbjct: 289 VVTFLKFIKKIQIFGIMITKACMSASNLIQRTPNIC 324 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 22.2 bits (45), Expect = 4.7 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +2 Query: 491 FYLYHQRLIAICNIE 535 FY HQ++IA NIE Sbjct: 232 FYYMHQQIIARFNIE 246 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 21.4 bits (43), Expect = 8.2 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 186 VWKIINKKLRKMFTSKPIYI 245 VWK I RK F + IY+ Sbjct: 231 VWKRIPHDYRKRFRMEKIYV 250 >AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory receptor candidate 9 protein. Length = 408 Score = 21.4 bits (43), Expect = 8.2 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = -2 Query: 232 LLVNILRNFLLIIFQTTRYF 173 +L + L NF IIFQ F Sbjct: 289 ILTSFLNNFYFIIFQVFESF 308 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 140,297 Number of Sequences: 336 Number of extensions: 2905 Number of successful extensions: 10 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20546262 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -