BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_F13 (778 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY321476-2|AAQ23387.1| 257|Tribolium castaneum Ase protein. 22 4.8 AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment h... 22 6.3 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 22 6.3 >AY321476-2|AAQ23387.1| 257|Tribolium castaneum Ase protein. Length = 257 Score = 22.2 bits (45), Expect = 4.8 Identities = 6/15 (40%), Positives = 11/15 (73%) Frame = +2 Query: 113 LIDLLXWWGQRLQPR 157 ++D++ WW Q+ PR Sbjct: 239 VMDVMQWWEQQQTPR 253 >AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment homeodomain protein protein. Length = 232 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = -1 Query: 424 SMKSTMEDEKLKEKISDSD 368 S+ S EDE+++ ++SD D Sbjct: 18 SLLSKKEDEEVEHRLSDRD 36 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 21.8 bits (44), Expect = 6.3 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = -3 Query: 680 GIPPAPRGVPQIEVTXDIDANGILNVSAIEKS 585 G+ A V I+ D+D NG N + ++K+ Sbjct: 60 GVNDADWSVLVIDPELDVDQNGFRNFTNLKKT 91 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,937 Number of Sequences: 336 Number of extensions: 2790 Number of successful extensions: 12 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20961338 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -