BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_F11 (841 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58150| Best HMM Match : ig (HMM E-Value=3.7e-24) 30 2.0 SB_23441| Best HMM Match : IncA (HMM E-Value=2.5) 30 2.7 SB_22729| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_31145| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.2 >SB_58150| Best HMM Match : ig (HMM E-Value=3.7e-24) Length = 456 Score = 30.3 bits (65), Expect = 2.0 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 Query: 695 EGXPKPYARWTRYG 736 +G PKP+ +WTRYG Sbjct: 46 DGLPKPFVKWTRYG 59 >SB_23441| Best HMM Match : IncA (HMM E-Value=2.5) Length = 927 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -3 Query: 710 VSDXLPLLYITXVPCSFSHISRPVQPCCCGCSASRD 603 V+ +P+L++ +PC ++S CCC C RD Sbjct: 407 VAVAVPILFLISLPCLLVNMS-----CCCSCKPKRD 437 >SB_22729| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 426 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +1 Query: 49 TNHVYLLIPGNTMFVTRSCNCQQSHER 129 +N V LLIPG+++ S NC++ H++ Sbjct: 17 SNQVKLLIPGSSVCPLNSLNCKEKHKQ 43 >SB_31145| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 28.3 bits (60), Expect = 8.2 Identities = 17/60 (28%), Positives = 30/60 (50%), Gaps = 2/60 (3%) Frame = -3 Query: 296 IYETVEPPGYSVPVS--CGVKVKPGFEKYYVLSSFQCSSGCMYPNYTVVSLY*NVIISLS 123 IY ++E PG +VP S C V F L +++C + T V + ++++S+S Sbjct: 10 IYASMETPGVAVPQSRICDVSTHDAFLLGQSLETYECKPN----DVTAVQCFVSILLSIS 65 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,689,043 Number of Sequences: 59808 Number of extensions: 429168 Number of successful extensions: 958 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 850 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 958 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2371447782 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -