BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_F10 (789 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 25 0.52 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 23 2.1 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 23 2.1 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 22 6.4 AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory recept... 22 6.4 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 22 6.4 AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 22 6.4 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 25.4 bits (53), Expect = 0.52 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 667 PPVSTSHWSRTRQSSLPRRPT 605 PP +T+HW +S RPT Sbjct: 1176 PPSTTNHWQTKTTTSTTTRPT 1196 Score = 21.8 bits (44), Expect = 6.4 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = -1 Query: 450 PSKPSVLSNSSTGVQPVSRSVSTTSHP 370 P+KPS S+T + STT+ P Sbjct: 1169 PTKPSYRPPSTTNHWQTKTTTSTTTRP 1195 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 23.4 bits (48), Expect = 2.1 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +1 Query: 115 PHPRLQRSPCRLLRNPSRGQPGP 183 PHP L P L +P+ PGP Sbjct: 232 PHPGLSPHPPHLSSHPAIVTPGP 254 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 23.4 bits (48), Expect = 2.1 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +1 Query: 115 PHPRLQRSPCRLLRNPSRGQPGP 183 PHP L P L +P+ PGP Sbjct: 124 PHPGLSPHPPHLSSHPAIVTPGP 146 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 21.8 bits (44), Expect = 6.4 Identities = 14/47 (29%), Positives = 19/47 (40%) Frame = +1 Query: 460 PRSHPWVRRHHGTAYSKPCTCHDGGRISPSGWRARSMRL*SRATESC 600 PRS RR+ G A C + R+ P+G R + S C Sbjct: 279 PRSQ---RRYTGRATCDCPNCQEAERLGPAGVHLRKKNIHSCHIPGC 322 >AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory receptor candidate 16 protein. Length = 452 Score = 21.8 bits (44), Expect = 6.4 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -1 Query: 513 WLAVCCTVVTSYPRM 469 W VC VV YPR+ Sbjct: 166 WREVCTFVVQVYPRL 180 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.8 bits (44), Expect = 6.4 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +2 Query: 548 LVGGLEACVCDLG 586 L+GG +C CDLG Sbjct: 703 LMGGKWSCDCDLG 715 >AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less protein. Length = 312 Score = 21.8 bits (44), Expect = 6.4 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +1 Query: 493 GTAYSKPCTCHDGGRISPSG 552 G A++ P HD G SP G Sbjct: 50 GNAHTGPTGTHDAGFPSPRG 69 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,024 Number of Sequences: 336 Number of extensions: 4409 Number of successful extensions: 15 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21376414 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -