BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_F09 (811 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47198| Best HMM Match : Tubulin (HMM E-Value=0) 132 2e-31 SB_39308| Best HMM Match : Tubulin (HMM E-Value=0) 132 2e-31 SB_17879| Best HMM Match : Tubulin (HMM E-Value=0) 132 2e-31 SB_44780| Best HMM Match : 7tm_1 (HMM E-Value=1.2e-34) 116 3e-26 SB_17651| Best HMM Match : Tubulin_C (HMM E-Value=4.7e-28) 116 3e-26 SB_25311| Best HMM Match : Tubulin (HMM E-Value=0) 73 4e-18 SB_17880| Best HMM Match : Tubulin_C (HMM E-Value=0) 81 1e-15 SB_22191| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_2674| Best HMM Match : Tubulin (HMM E-Value=0) 54 2e-07 SB_47795| Best HMM Match : Tubulin_C (HMM E-Value=0.24) 53 2e-07 SB_22192| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_42897| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_37573| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_22193| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_19437| Best HMM Match : Tubulin (HMM E-Value=0) 52 4e-07 SB_51156| Best HMM Match : Tubulin_C (HMM E-Value=0) 52 4e-07 SB_23895| Best HMM Match : Tubulin_C (HMM E-Value=0) 52 4e-07 SB_2003| Best HMM Match : Tubulin (HMM E-Value=0) 52 4e-07 SB_48961| Best HMM Match : Tubulin (HMM E-Value=0) 52 6e-07 SB_22190| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_51150| Best HMM Match : Tubulin_C (HMM E-Value=0) 52 7e-07 SB_5512| Best HMM Match : Tubulin (HMM E-Value=0) 52 7e-07 SB_57880| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_40336| Best HMM Match : Tubulin_C (HMM E-Value=1.3e-32) 38 0.007 SB_13374| Best HMM Match : Cornifin (HMM E-Value=0.34) 31 1.1 SB_26881| Best HMM Match : Atrophin-1 (HMM E-Value=0.86) 29 4.5 SB_5677| Best HMM Match : fn3 (HMM E-Value=0.0092) 28 7.8 >SB_47198| Best HMM Match : Tubulin (HMM E-Value=0) Length = 446 Score = 132 bits (320), Expect = 2e-31 Identities = 65/105 (61%), Positives = 77/105 (73%), Gaps = 1/105 (0%) Frame = -1 Query: 793 SIQXK-TAVFXRGIPXXVKTARCDIPPKV*RCRLRLSGTRQPSRNYXKRISEQFSAMFRR 617 ++Q K ++ F IP VKTA CDIPP+ + G + KRISEQF+AMFRR Sbjct: 332 NVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRR 391 Query: 616 KAFLHWYTGEGMDEMEFNEAESNVNDLVSEY*QYQEATAEDDTEF 482 KAFLHWYTGEGMDEMEF EAESN+NDLVSEY QYQ+ATAE++ EF Sbjct: 392 KAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEF 436 >SB_39308| Best HMM Match : Tubulin (HMM E-Value=0) Length = 391 Score = 132 bits (320), Expect = 2e-31 Identities = 65/105 (61%), Positives = 77/105 (73%), Gaps = 1/105 (0%) Frame = -1 Query: 793 SIQXK-TAVFXRGIPXXVKTARCDIPPKV*RCRLRLSGTRQPSRNYXKRISEQFSAMFRR 617 ++Q K ++ F IP VKTA CDIPP+ + G + KRISEQF+AMFRR Sbjct: 277 NVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRR 336 Query: 616 KAFLHWYTGEGMDEMEFNEAESNVNDLVSEY*QYQEATAEDDTEF 482 KAFLHWYTGEGMDEMEF EAESN+NDLVSEY QYQ+ATAE++ EF Sbjct: 337 KAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEF 381 >SB_17879| Best HMM Match : Tubulin (HMM E-Value=0) Length = 446 Score = 132 bits (320), Expect = 2e-31 Identities = 65/105 (61%), Positives = 77/105 (73%), Gaps = 1/105 (0%) Frame = -1 Query: 793 SIQXK-TAVFXRGIPXXVKTARCDIPPKV*RCRLRLSGTRQPSRNYXKRISEQFSAMFRR 617 ++Q K ++ F IP VKTA CDIPP+ + G + KRISEQF+AMFRR Sbjct: 332 NVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRR 391 Query: 616 KAFLHWYTGEGMDEMEFNEAESNVNDLVSEY*QYQEATAEDDTEF 482 KAFLHWYTGEGMDEMEF EAESN+NDLVSEY QYQ+ATAE++ EF Sbjct: 392 KAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEF 436 >SB_44780| Best HMM Match : 7tm_1 (HMM E-Value=1.2e-34) Length = 747 Score = 116 bits (278), Expect = 3e-26 Identities = 55/95 (57%), Positives = 65/95 (68%) Frame = -1 Query: 769 FXRGIPXXVKTARCDIPPKV*RCRLRLSGTRQPSRNYXKRISEQFSAMFRRKAFLHWYTG 590 F IP VKT CDI PK + G + KR+ EQF+AMFRRKAFLHWYTG Sbjct: 106 FVEWIPNNVKTTVCDIAPKGLKMAATFVGNNTAIQELFKRVGEQFTAMFRRKAFLHWYTG 165 Query: 589 EGMDEMEFNEAESNVNDLVSEY*QYQEATAEDDTE 485 EGMDEMEF EAESN++DL++EY QYQEA A+ + E Sbjct: 166 EGMDEMEFTEAESNMHDLIAEYQQYQEAEADIEGE 200 >SB_17651| Best HMM Match : Tubulin_C (HMM E-Value=4.7e-28) Length = 271 Score = 116 bits (278), Expect = 3e-26 Identities = 55/95 (57%), Positives = 65/95 (68%) Frame = -1 Query: 769 FXRGIPXXVKTARCDIPPKV*RCRLRLSGTRQPSRNYXKRISEQFSAMFRRKAFLHWYTG 590 F IP VKT CDI PK + G + KR+ EQF+AMFRRKAFLHWYTG Sbjct: 168 FVEWIPNNVKTTVCDIAPKGLKMAATFVGNNTAIQELFKRVGEQFTAMFRRKAFLHWYTG 227 Query: 589 EGMDEMEFNEAESNVNDLVSEY*QYQEATAEDDTE 485 EGMDEMEF EAESN++DL++EY QYQEA A+ + E Sbjct: 228 EGMDEMEFTEAESNMHDLIAEYQQYQEAEADIEGE 262 >SB_25311| Best HMM Match : Tubulin (HMM E-Value=0) Length = 629 Score = 72.5 bits (170), Expect(2) = 4e-18 Identities = 34/74 (45%), Positives = 44/74 (59%) Frame = -1 Query: 769 FXRGIPXXVKTARCDIPPKV*RCRLRLSGTRQPSRNYXKRISEQFSAMFRRKAFLHWYTG 590 F IP +KTA CD+PP + + +R +EQF+AMFRR+AFLHWYT Sbjct: 160 FVEWIPNNMKTAVCDVPPVGLKNAATFLYNSTAIQEAFRRFTEQFAAMFRRRAFLHWYTT 219 Query: 589 EGMDEMEFNEAESN 548 EGMD +EF E + N Sbjct: 220 EGMDPLEFTEIKRN 233 Score = 37.1 bits (82), Expect(2) = 4e-18 Identities = 14/23 (60%), Positives = 21/23 (91%) Frame = -1 Query: 559 AESNVNDLVSEY*QYQEATAEDD 491 A+SN+NDL+SEY QY++A ++DD Sbjct: 259 ADSNLNDLISEYQQYEDAKSDDD 281 >SB_17880| Best HMM Match : Tubulin_C (HMM E-Value=0) Length = 375 Score = 81.0 bits (191), Expect = 1e-15 Identities = 38/95 (40%), Positives = 55/95 (57%) Frame = -1 Query: 778 TAVFXRGIPXXVKTARCDIPPKV*RCRLRLSGTRQPSRNYXKRISEQFSAMFRRKAFLHW 599 +++F IP K A CD+PP + + + KRI + MFRR+AFLHW Sbjct: 243 SSLFVDWIPNNGKVAVCDVPPHDMKMSASCISSNTAIQELFKRIRLHYKLMFRRRAFLHW 302 Query: 598 YTGEGMDEMEFNEAESNVNDLVSEY*QYQEATAED 494 YT EGMD +F EA++++ DL+S Y Q ++ AED Sbjct: 303 YTEEGMDSQQFEEADNDILDLISTYQQCEDMKAED 337 >SB_22191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 865 Score = 56.4 bits (130), Expect = 3e-08 Identities = 28/77 (36%), Positives = 44/77 (57%) Frame = -1 Query: 715 KV*RCRLRLSGTRQPSRNYXKRISEQFSAMFRRKAFLHWYTGEGMDEMEFNEAESNVNDL 536 KV R LS T + + R+ +F M+ ++AF+HWY GEGM+E EF+EA ++ L Sbjct: 786 KVQRAVCMLSNTTAIAEAWA-RLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAAL 844 Query: 535 VSEY*QYQEATAEDDTE 485 +Y + + E+D E Sbjct: 845 EKDYEEVAVESVEEDEE 861 Score = 52.0 bits (119), Expect = 6e-07 Identities = 25/64 (39%), Positives = 38/64 (59%) Frame = -1 Query: 715 KV*RCRLRLSGTRQPSRNYXKRISEQFSAMFRRKAFLHWYTGEGMDEMEFNEAESNVNDL 536 KV R LS T + + R+ +F M+ ++AF+HWY GEGM+E EF+EA ++ L Sbjct: 355 KVQRAVCMLSNTTAIAEAWA-RLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAAL 413 Query: 535 VSEY 524 +Y Sbjct: 414 EKDY 417 >SB_2674| Best HMM Match : Tubulin (HMM E-Value=0) Length = 1036 Score = 53.6 bits (123), Expect = 2e-07 Identities = 27/77 (35%), Positives = 44/77 (57%) Frame = -1 Query: 715 KV*RCRLRLSGTRQPSRNYXKRISEQFSAMFRRKAFLHWYTGEGMDEMEFNEAESNVNDL 536 KV R LS T + + R+ +F M+ ++AF+HWY GEGM+E EF+EA ++ L Sbjct: 955 KVQRAVCMLSNTTAIAEAWA-RLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAAL 1013 Query: 535 VSEY*QYQEATAEDDTE 485 +Y + + E++ E Sbjct: 1014 EKDYEEVGVDSVEEEGE 1030 >SB_47795| Best HMM Match : Tubulin_C (HMM E-Value=0.24) Length = 149 Score = 53.2 bits (122), Expect = 2e-07 Identities = 21/56 (37%), Positives = 37/56 (66%) Frame = -1 Query: 652 RISEQFSAMFRRKAFLHWYTGEGMDEMEFNEAESNVNDLVSEY*QYQEATAEDDTE 485 R++ +F M+ ++AF+HWY GEGM+E EF+EA ++ L +Y + + ++D E Sbjct: 88 RLNHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVDSVDNDGE 143 >SB_22192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 452 Score = 52.8 bits (121), Expect = 3e-07 Identities = 27/77 (35%), Positives = 43/77 (55%) Frame = -1 Query: 715 KV*RCRLRLSGTRQPSRNYXKRISEQFSAMFRRKAFLHWYTGEGMDEMEFNEAESNVNDL 536 KV R LS T + + R+ +F M+ ++AF+HWY GEGM+E EF+EA ++ L Sbjct: 370 KVQRAVCMLSNTTAIAEAWA-RLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAAL 428 Query: 535 VSEY*QYQEATAEDDTE 485 +Y + + E+ E Sbjct: 429 EKDYEEVGVDSVEEGEE 445 >SB_42897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 52.4 bits (120), Expect = 4e-07 Identities = 28/76 (36%), Positives = 44/76 (57%) Frame = -1 Query: 715 KV*RCRLRLSGTRQPSRNYXKRISEQFSAMFRRKAFLHWYTGEGMDEMEFNEAESNVNDL 536 KV R LS T + + R+ +F M+ ++AF+HWY GEGM+E EF+EA ++ L Sbjct: 522 KVQRAVCMLSNTTAIAEAWA-RLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAAL 580 Query: 535 VSEY*QYQEATAEDDT 488 +Y + A + DD+ Sbjct: 581 EKDY-EEVGADSPDDS 595 >SB_37573| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 389 Score = 52.4 bits (120), Expect = 4e-07 Identities = 27/77 (35%), Positives = 43/77 (55%) Frame = -1 Query: 715 KV*RCRLRLSGTRQPSRNYXKRISEQFSAMFRRKAFLHWYTGEGMDEMEFNEAESNVNDL 536 KV R LS T + + R+ +F M+ ++AF+HWY GEGM+E EF+EA ++ L Sbjct: 307 KVQRAVCMLSNTTAIAEAWA-RLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAAL 365 Query: 535 VSEY*QYQEATAEDDTE 485 +Y + + E + E Sbjct: 366 EKDYEEVGVDSVEGEGE 382 >SB_22193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1231 Score = 52.4 bits (120), Expect = 4e-07 Identities = 27/77 (35%), Positives = 43/77 (55%) Frame = -1 Query: 715 KV*RCRLRLSGTRQPSRNYXKRISEQFSAMFRRKAFLHWYTGEGMDEMEFNEAESNVNDL 536 KV R LS T + + R+ +F M+ ++AF+HWY GEGM+E EF+EA ++ L Sbjct: 1150 KVQRAVCMLSNTTAIAEAWA-RLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAAL 1208 Query: 535 VSEY*QYQEATAEDDTE 485 +Y + + E + E Sbjct: 1209 EKDYEEVGVDSVEGEGE 1225 Score = 52.0 bits (119), Expect = 6e-07 Identities = 25/64 (39%), Positives = 38/64 (59%) Frame = -1 Query: 715 KV*RCRLRLSGTRQPSRNYXKRISEQFSAMFRRKAFLHWYTGEGMDEMEFNEAESNVNDL 536 KV R LS T + + R+ +F M+ ++AF+HWY GEGM+E EF+EA ++ L Sbjct: 741 KVQRAVCMLSNTTAIAEAWA-RLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAAL 799 Query: 535 VSEY 524 +Y Sbjct: 800 EKDY 803 >SB_19437| Best HMM Match : Tubulin (HMM E-Value=0) Length = 885 Score = 52.4 bits (120), Expect = 4e-07 Identities = 25/64 (39%), Positives = 38/64 (59%) Frame = -1 Query: 715 KV*RCRLRLSGTRQPSRNYXKRISEQFSAMFRRKAFLHWYTGEGMDEMEFNEAESNVNDL 536 KV R LS T + + R+ +F M+ ++AF+HWY GEGM+E EF+EA ++ L Sbjct: 370 KVQRAVCMLSNTTAVAEAWA-RLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAAL 428 Query: 535 VSEY 524 +Y Sbjct: 429 EKDY 432 Score = 52.4 bits (120), Expect = 4e-07 Identities = 27/77 (35%), Positives = 43/77 (55%) Frame = -1 Query: 715 KV*RCRLRLSGTRQPSRNYXKRISEQFSAMFRRKAFLHWYTGEGMDEMEFNEAESNVNDL 536 KV R LS T + + R+ +F M+ ++AF+HWY GEGM+E EF+EA ++ L Sbjct: 803 KVQRAVCMLSNTTAIAEAWA-RLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAAL 861 Query: 535 VSEY*QYQEATAEDDTE 485 +Y + + E + E Sbjct: 862 EKDYEEVGVDSVEGEGE 878 >SB_51156| Best HMM Match : Tubulin_C (HMM E-Value=0) Length = 377 Score = 52.4 bits (120), Expect = 4e-07 Identities = 27/77 (35%), Positives = 43/77 (55%) Frame = -1 Query: 715 KV*RCRLRLSGTRQPSRNYXKRISEQFSAMFRRKAFLHWYTGEGMDEMEFNEAESNVNDL 536 KV R LS T + + R+ +F M+ ++AF+HWY GEGM+E EF+EA ++ L Sbjct: 295 KVQRAVCMLSNTTAIAEAWA-RLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAAL 353 Query: 535 VSEY*QYQEATAEDDTE 485 +Y + + E + E Sbjct: 354 EKDYEEVGVDSVEGEGE 370 >SB_23895| Best HMM Match : Tubulin_C (HMM E-Value=0) Length = 250 Score = 52.4 bits (120), Expect = 4e-07 Identities = 27/77 (35%), Positives = 43/77 (55%) Frame = -1 Query: 715 KV*RCRLRLSGTRQPSRNYXKRISEQFSAMFRRKAFLHWYTGEGMDEMEFNEAESNVNDL 536 KV R LS T + + R+ +F M+ ++AF+HWY GEGM+E EF+EA ++ L Sbjct: 168 KVQRAVCMLSNTTAIAEAWA-RLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAAL 226 Query: 535 VSEY*QYQEATAEDDTE 485 +Y + + E + E Sbjct: 227 EKDYEEVGVDSVEGEGE 243 >SB_2003| Best HMM Match : Tubulin (HMM E-Value=0) Length = 451 Score = 52.4 bits (120), Expect = 4e-07 Identities = 27/77 (35%), Positives = 43/77 (55%) Frame = -1 Query: 715 KV*RCRLRLSGTRQPSRNYXKRISEQFSAMFRRKAFLHWYTGEGMDEMEFNEAESNVNDL 536 KV R LS T + + R+ +F M+ ++AF+HWY GEGM+E EF+EA ++ L Sbjct: 370 KVQRAVCMLSNTTAIAEAWA-RLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAAL 428 Query: 535 VSEY*QYQEATAEDDTE 485 +Y + + E + E Sbjct: 429 EKDYEEVGVDSVEGEGE 445 >SB_48961| Best HMM Match : Tubulin (HMM E-Value=0) Length = 536 Score = 52.0 bits (119), Expect = 6e-07 Identities = 25/64 (39%), Positives = 38/64 (59%) Frame = -1 Query: 715 KV*RCRLRLSGTRQPSRNYXKRISEQFSAMFRRKAFLHWYTGEGMDEMEFNEAESNVNDL 536 KV R LS T + + R+ +F M+ ++AF+HWY GEGM+E EF+EA ++ L Sbjct: 354 KVQRAVCMLSNTTAIAEAWA-RLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAAL 412 Query: 535 VSEY 524 +Y Sbjct: 413 EKDY 416 >SB_22190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 417 Score = 52.0 bits (119), Expect = 6e-07 Identities = 25/64 (39%), Positives = 38/64 (59%) Frame = -1 Query: 715 KV*RCRLRLSGTRQPSRNYXKRISEQFSAMFRRKAFLHWYTGEGMDEMEFNEAESNVNDL 536 KV R LS T + + R+ +F M+ ++AF+HWY GEGM+E EF+EA ++ L Sbjct: 335 KVQRAVCMLSNTTAIAEAWA-RLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAAL 393 Query: 535 VSEY 524 +Y Sbjct: 394 EKDY 397 >SB_51150| Best HMM Match : Tubulin_C (HMM E-Value=0) Length = 232 Score = 51.6 bits (118), Expect = 7e-07 Identities = 19/43 (44%), Positives = 31/43 (72%) Frame = -1 Query: 652 RISEQFSAMFRRKAFLHWYTGEGMDEMEFNEAESNVNDLVSEY 524 R++ +F M+ ++AF+HWY GEGM+E EF+EA ++ L +Y Sbjct: 188 RLNHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 230 >SB_5512| Best HMM Match : Tubulin (HMM E-Value=0) Length = 365 Score = 51.6 bits (118), Expect = 7e-07 Identities = 20/51 (39%), Positives = 32/51 (62%) Frame = -1 Query: 676 QPSRNYXKRISEQFSAMFRRKAFLHWYTGEGMDEMEFNEAESNVNDLVSEY 524 +P R+ +F M+ ++AF+HWY GEGM+E EF+EA ++ L +Y Sbjct: 295 KPIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY 345 >SB_57880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/47 (38%), Positives = 30/47 (63%) Frame = -1 Query: 625 FRRKAFLHWYTGEGMDEMEFNEAESNVNDLVSEY*QYQEATAEDDTE 485 + ++AF+HWY GEGM+E EF+EA ++ L +Y + + E + E Sbjct: 13 YAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVDSVEGEGE 59 >SB_40336| Best HMM Match : Tubulin_C (HMM E-Value=1.3e-32) Length = 488 Score = 38.3 bits (85), Expect = 0.007 Identities = 19/74 (25%), Positives = 38/74 (51%), Gaps = 1/74 (1%) Frame = -1 Query: 742 KTARCDIPPKV*RCRLRLSGTRQPSRNYXKRISEQFSAMFRRKAFLHWYTG-EGMDEMEF 566 KT C +PP L +N + ++F +++RKA +H YT +G++ +F Sbjct: 397 KTGLCSVPPVGQPYSLLTLANNSCIKNTFVELKDRFMKLYKRKAHVHHYTHVDGLEVGQF 456 Query: 565 NEAESNVNDLVSEY 524 ++ +++ L+ EY Sbjct: 457 DDGLESLSWLIQEY 470 >SB_13374| Best HMM Match : Cornifin (HMM E-Value=0.34) Length = 1197 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = +1 Query: 418 GSEVRSSHGARPAPTPPGLLGRTRCRLPRWPPGTVSTQTP 537 G+E S+ GA + TP L RT P PG S+ TP Sbjct: 988 GAESSSTPGAASSSTPGAALSRTPGAAPSSTPGAASSTTP 1027 >SB_26881| Best HMM Match : Atrophin-1 (HMM E-Value=0.86) Length = 1110 Score = 29.1 bits (62), Expect = 4.5 Identities = 18/50 (36%), Positives = 23/50 (46%) Frame = -2 Query: 672 HPGTIXREYPSSSLPCSDVKLSCTGTPARAWTRWSSTKQRATSTIWCLST 523 HPGT+ S SLP S + S + P+RA + S T S C T Sbjct: 74 HPGTLATFASSPSLPVSPLVSSHSAIPSRAKSPLSLTISDGDSASTCSET 123 >SB_5677| Best HMM Match : fn3 (HMM E-Value=0.0092) Length = 1146 Score = 28.3 bits (60), Expect = 7.8 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +1 Query: 436 SHGARPAPTPPGLLGRTRCRLPRWPPGTVSTQTPDR 543 SHGARPA + G RC + + PGT+ T + R Sbjct: 918 SHGARPAMSQSQREGNDRCVV--YQPGTIETISDGR 951 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,643,016 Number of Sequences: 59808 Number of extensions: 397709 Number of successful extensions: 1126 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 899 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1113 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2251677692 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -