BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_C22 (711 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51150| Best HMM Match : Tubulin_C (HMM E-Value=0) 57 2e-08 SB_48961| Best HMM Match : Tubulin (HMM E-Value=0) 57 2e-08 SB_47795| Best HMM Match : Tubulin_C (HMM E-Value=0.24) 57 2e-08 SB_42897| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_37573| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_22193| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_22192| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_22191| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_22190| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_19437| Best HMM Match : Tubulin (HMM E-Value=0) 57 2e-08 SB_2674| Best HMM Match : Tubulin (HMM E-Value=0) 57 2e-08 SB_51156| Best HMM Match : Tubulin_C (HMM E-Value=0) 57 2e-08 SB_23895| Best HMM Match : Tubulin_C (HMM E-Value=0) 57 2e-08 SB_5512| Best HMM Match : Tubulin (HMM E-Value=0) 57 2e-08 SB_2003| Best HMM Match : Tubulin (HMM E-Value=0) 57 2e-08 SB_57880| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_47198| Best HMM Match : Tubulin (HMM E-Value=0) 40 0.002 SB_44780| Best HMM Match : 7tm_1 (HMM E-Value=1.2e-34) 40 0.002 SB_39308| Best HMM Match : Tubulin (HMM E-Value=0) 40 0.002 SB_17879| Best HMM Match : Tubulin (HMM E-Value=0) 40 0.002 SB_17651| Best HMM Match : Tubulin_C (HMM E-Value=4.7e-28) 40 0.002 SB_17880| Best HMM Match : Tubulin_C (HMM E-Value=0) 36 0.025 SB_25311| Best HMM Match : Tubulin (HMM E-Value=0) 34 0.13 SB_31500| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 29 2.8 SB_2033| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 >SB_51150| Best HMM Match : Tubulin_C (HMM E-Value=0) Length = 232 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = -2 Query: 266 DLXYXKRAFVHWYVGEGMEEGEFSEA 189 DL Y KRAFVHWYVGEGMEEGEFSEA Sbjct: 194 DLMYAKRAFVHWYVGEGMEEGEFSEA 219 Score = 30.3 bits (65), Expect = 1.6 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 187 REDLAALEKDYEE 149 REDLAALEKDYEE Sbjct: 220 REDLAALEKDYEE 232 >SB_48961| Best HMM Match : Tubulin (HMM E-Value=0) Length = 536 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = -2 Query: 266 DLXYXKRAFVHWYVGEGMEEGEFSEA 189 DL Y KRAFVHWYVGEGMEEGEFSEA Sbjct: 380 DLMYAKRAFVHWYVGEGMEEGEFSEA 405 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 187 REDLAALEKDYEEVGMDS 134 REDLAALEKDYEEVG+DS Sbjct: 406 REDLAALEKDYEEVGVDS 423 >SB_47795| Best HMM Match : Tubulin_C (HMM E-Value=0.24) Length = 149 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = -2 Query: 266 DLXYXKRAFVHWYVGEGMEEGEFSEA 189 DL Y KRAFVHWYVGEGMEEGEFSEA Sbjct: 94 DLMYAKRAFVHWYVGEGMEEGEFSEA 119 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 187 REDLAALEKDYEEVGMDS 134 REDLAALEKDYEEVG+DS Sbjct: 120 REDLAALEKDYEEVGVDS 137 >SB_42897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = -2 Query: 266 DLXYXKRAFVHWYVGEGMEEGEFSEA 189 DL Y KRAFVHWYVGEGMEEGEFSEA Sbjct: 548 DLMYAKRAFVHWYVGEGMEEGEFSEA 573 Score = 37.9 bits (84), Expect = 0.008 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -3 Query: 187 REDLAALEKDYEEVGMDS 134 REDLAALEKDYEEVG DS Sbjct: 574 REDLAALEKDYEEVGADS 591 >SB_37573| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 389 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = -2 Query: 266 DLXYXKRAFVHWYVGEGMEEGEFSEA 189 DL Y KRAFVHWYVGEGMEEGEFSEA Sbjct: 333 DLMYAKRAFVHWYVGEGMEEGEFSEA 358 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 187 REDLAALEKDYEEVGMDS 134 REDLAALEKDYEEVG+DS Sbjct: 359 REDLAALEKDYEEVGVDS 376 >SB_22193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1231 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = -2 Query: 266 DLXYXKRAFVHWYVGEGMEEGEFSEA 189 DL Y KRAFVHWYVGEGMEEGEFSEA Sbjct: 767 DLMYAKRAFVHWYVGEGMEEGEFSEA 792 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = -2 Query: 266 DLXYXKRAFVHWYVGEGMEEGEFSEA 189 DL Y KRAFVHWYVGEGMEEGEFSEA Sbjct: 1176 DLMYAKRAFVHWYVGEGMEEGEFSEA 1201 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 187 REDLAALEKDYEEVGMDS 134 REDLAALEKDYEEVG+DS Sbjct: 1202 REDLAALEKDYEEVGVDS 1219 Score = 30.3 bits (65), Expect = 1.6 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 187 REDLAALEKDYEE 149 REDLAALEKDYEE Sbjct: 793 REDLAALEKDYEE 805 >SB_22192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 452 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = -2 Query: 266 DLXYXKRAFVHWYVGEGMEEGEFSEA 189 DL Y KRAFVHWYVGEGMEEGEFSEA Sbjct: 396 DLMYAKRAFVHWYVGEGMEEGEFSEA 421 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 187 REDLAALEKDYEEVGMDS 134 REDLAALEKDYEEVG+DS Sbjct: 422 REDLAALEKDYEEVGVDS 439 >SB_22191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 865 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = -2 Query: 266 DLXYXKRAFVHWYVGEGMEEGEFSEA 189 DL Y KRAFVHWYVGEGMEEGEFSEA Sbjct: 381 DLMYAKRAFVHWYVGEGMEEGEFSEA 406 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = -2 Query: 266 DLXYXKRAFVHWYVGEGMEEGEFSEA 189 DL Y KRAFVHWYVGEGMEEGEFSEA Sbjct: 812 DLMYAKRAFVHWYVGEGMEEGEFSEA 837 Score = 34.7 bits (76), Expect = 0.075 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -3 Query: 187 REDLAALEKDYEEVGMDS 134 REDLAALEKDYEEV ++S Sbjct: 838 REDLAALEKDYEEVAVES 855 Score = 30.3 bits (65), Expect = 1.6 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 187 REDLAALEKDYEE 149 REDLAALEKDYEE Sbjct: 407 REDLAALEKDYEE 419 >SB_22190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 417 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = -2 Query: 266 DLXYXKRAFVHWYVGEGMEEGEFSEA 189 DL Y KRAFVHWYVGEGMEEGEFSEA Sbjct: 361 DLMYAKRAFVHWYVGEGMEEGEFSEA 386 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 187 REDLAALEKDYEEVGMDS 134 REDLAALEKDYEEVG+DS Sbjct: 387 REDLAALEKDYEEVGVDS 404 >SB_19437| Best HMM Match : Tubulin (HMM E-Value=0) Length = 885 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = -2 Query: 266 DLXYXKRAFVHWYVGEGMEEGEFSEA 189 DL Y KRAFVHWYVGEGMEEGEFSEA Sbjct: 396 DLMYAKRAFVHWYVGEGMEEGEFSEA 421 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = -2 Query: 266 DLXYXKRAFVHWYVGEGMEEGEFSEA 189 DL Y KRAFVHWYVGEGMEEGEFSEA Sbjct: 829 DLMYAKRAFVHWYVGEGMEEGEFSEA 854 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 187 REDLAALEKDYEEVGMDS 134 REDLAALEKDYEEVG+DS Sbjct: 855 REDLAALEKDYEEVGVDS 872 Score = 30.3 bits (65), Expect = 1.6 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 187 REDLAALEKDYEE 149 REDLAALEKDYEE Sbjct: 422 REDLAALEKDYEE 434 >SB_2674| Best HMM Match : Tubulin (HMM E-Value=0) Length = 1036 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = -2 Query: 266 DLXYXKRAFVHWYVGEGMEEGEFSEA 189 DL Y KRAFVHWYVGEGMEEGEFSEA Sbjct: 981 DLMYAKRAFVHWYVGEGMEEGEFSEA 1006 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 187 REDLAALEKDYEEVGMDS 134 REDLAALEKDYEEVG+DS Sbjct: 1007 REDLAALEKDYEEVGVDS 1024 >SB_51156| Best HMM Match : Tubulin_C (HMM E-Value=0) Length = 377 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = -2 Query: 266 DLXYXKRAFVHWYVGEGMEEGEFSEA 189 DL Y KRAFVHWYVGEGMEEGEFSEA Sbjct: 321 DLMYAKRAFVHWYVGEGMEEGEFSEA 346 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 187 REDLAALEKDYEEVGMDS 134 REDLAALEKDYEEVG+DS Sbjct: 347 REDLAALEKDYEEVGVDS 364 >SB_23895| Best HMM Match : Tubulin_C (HMM E-Value=0) Length = 250 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = -2 Query: 266 DLXYXKRAFVHWYVGEGMEEGEFSEA 189 DL Y KRAFVHWYVGEGMEEGEFSEA Sbjct: 194 DLMYAKRAFVHWYVGEGMEEGEFSEA 219 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 187 REDLAALEKDYEEVGMDS 134 REDLAALEKDYEEVG+DS Sbjct: 220 REDLAALEKDYEEVGVDS 237 >SB_5512| Best HMM Match : Tubulin (HMM E-Value=0) Length = 365 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = -2 Query: 266 DLXYXKRAFVHWYVGEGMEEGEFSEA 189 DL Y KRAFVHWYVGEGMEEGEFSEA Sbjct: 309 DLMYAKRAFVHWYVGEGMEEGEFSEA 334 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 187 REDLAALEKDYEEVGMDS 134 REDLAALEKDYEEVG+DS Sbjct: 335 REDLAALEKDYEEVGVDS 352 >SB_2003| Best HMM Match : Tubulin (HMM E-Value=0) Length = 451 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = -2 Query: 266 DLXYXKRAFVHWYVGEGMEEGEFSEA 189 DL Y KRAFVHWYVGEGMEEGEFSEA Sbjct: 396 DLMYAKRAFVHWYVGEGMEEGEFSEA 421 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 187 REDLAALEKDYEEVGMDS 134 REDLAALEKDYEEVG+DS Sbjct: 422 REDLAALEKDYEEVGVDS 439 >SB_57880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 54.0 bits (124), Expect = 1e-07 Identities = 23/26 (88%), Positives = 23/26 (88%) Frame = -2 Query: 266 DLXYXKRAFVHWYVGEGMEEGEFSEA 189 D Y KRAFVHWYVGEGMEEGEFSEA Sbjct: 10 DHDYAKRAFVHWYVGEGMEEGEFSEA 35 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 187 REDLAALEKDYEEVGMDS 134 REDLAALEKDYEEVG+DS Sbjct: 36 REDLAALEKDYEEVGVDS 53 >SB_47198| Best HMM Match : Tubulin (HMM E-Value=0) Length = 446 Score = 40.3 bits (90), Expect = 0.002 Identities = 14/23 (60%), Positives = 20/23 (86%) Frame = -2 Query: 257 YXKRAFVHWYVGEGMEEGEFSEA 189 + ++AF+HWY GEGM+E EF+EA Sbjct: 389 FRRKAFLHWYTGEGMDEMEFTEA 411 >SB_44780| Best HMM Match : 7tm_1 (HMM E-Value=1.2e-34) Length = 747 Score = 40.3 bits (90), Expect = 0.002 Identities = 14/23 (60%), Positives = 20/23 (86%) Frame = -2 Query: 257 YXKRAFVHWYVGEGMEEGEFSEA 189 + ++AF+HWY GEGM+E EF+EA Sbjct: 154 FRRKAFLHWYTGEGMDEMEFTEA 176 >SB_39308| Best HMM Match : Tubulin (HMM E-Value=0) Length = 391 Score = 40.3 bits (90), Expect = 0.002 Identities = 14/23 (60%), Positives = 20/23 (86%) Frame = -2 Query: 257 YXKRAFVHWYVGEGMEEGEFSEA 189 + ++AF+HWY GEGM+E EF+EA Sbjct: 334 FRRKAFLHWYTGEGMDEMEFTEA 356 >SB_17879| Best HMM Match : Tubulin (HMM E-Value=0) Length = 446 Score = 40.3 bits (90), Expect = 0.002 Identities = 14/23 (60%), Positives = 20/23 (86%) Frame = -2 Query: 257 YXKRAFVHWYVGEGMEEGEFSEA 189 + ++AF+HWY GEGM+E EF+EA Sbjct: 389 FRRKAFLHWYTGEGMDEMEFTEA 411 >SB_17651| Best HMM Match : Tubulin_C (HMM E-Value=4.7e-28) Length = 271 Score = 40.3 bits (90), Expect = 0.002 Identities = 14/23 (60%), Positives = 20/23 (86%) Frame = -2 Query: 257 YXKRAFVHWYVGEGMEEGEFSEA 189 + ++AF+HWY GEGM+E EF+EA Sbjct: 216 FRRKAFLHWYTGEGMDEMEFTEA 238 >SB_17880| Best HMM Match : Tubulin_C (HMM E-Value=0) Length = 375 Score = 36.3 bits (80), Expect = 0.025 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = -2 Query: 263 LXYXKRAFVHWYVGEGMEEGEFSEA 189 L + +RAF+HWY EGM+ +F EA Sbjct: 292 LMFRRRAFLHWYTEEGMDSQQFEEA 316 >SB_25311| Best HMM Match : Tubulin (HMM E-Value=0) Length = 629 Score = 33.9 bits (74), Expect = 0.13 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = -2 Query: 257 YXKRAFVHWYVGEGMEEGEFSE 192 + +RAF+HWY EGM+ EF+E Sbjct: 208 FRRRAFLHWYTTEGMDPLEFTE 229 >SB_31500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1446 Score = 30.7 bits (66), Expect = 1.2 Identities = 18/44 (40%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = +1 Query: 112 LPHPRLQRSPCRLLRNPSRGQPGPHGASENSP-SSIPSPTYQCT 240 LPHP S L +PSR P+ N+ SS PSP Y T Sbjct: 1026 LPHPSSPHSSSALYSSPSRTSNLPYTTYTNTAISSQPSPPYSST 1069 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 29.5 bits (63), Expect = 2.8 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = +1 Query: 112 LPHPRLQRSPCRLLRNPS-RGQPGPHGASENSPSSIPSPT 228 + +P + SP + NPS R P PH +S SP+ P+P+ Sbjct: 460 ISNPSISTSP---ISNPSPRPHPSPHPSSNPSPNPSPNPS 496 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 29.5 bits (63), Expect = 2.8 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -3 Query: 370 PPPXXXPGGIGQVXXPLQXXQTPPXPKXG 284 PPP PGGI P++ PP P G Sbjct: 196 PPPPPGPGGIPPPPPPIRGGVPPPPPMGG 224 >SB_2033| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 995 Score = 28.3 bits (60), Expect = 6.5 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = +1 Query: 82 KIFHWLSTLRLPHP-RLQRSPCRLLRNPSRGQPGPH 186 K+FH + L P RL+R +++R + G P PH Sbjct: 154 KLFHAVVVLEFPKSQRLERGQSQVIRCSAEGYPTPH 189 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,636,007 Number of Sequences: 59808 Number of extensions: 295597 Number of successful extensions: 695 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 583 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 692 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1877743452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -