BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_D22 (799 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19071| Best HMM Match : Ribosomal_L4 (HMM E-Value=0) 38 0.007 SB_54601| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_14316| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_23951| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 >SB_19071| Best HMM Match : Ribosomal_L4 (HMM E-Value=0) Length = 299 Score = 38.3 bits (85), Expect = 0.007 Identities = 18/34 (52%), Positives = 20/34 (58%) Frame = -3 Query: 713 QGLXRAFRNIPGVEXXXXXXXXXXXLAPGGHXGR 612 QGL +AFRN+PGVE L PGGH GR Sbjct: 212 QGLRQAFRNLPGVELQHVDRLNLLKLCPGGHLGR 245 Score = 32.7 bits (71), Expect = 0.35 Identities = 23/54 (42%), Positives = 28/54 (51%) Frame = -3 Query: 524 NLPQPKMANTDLTRLLKSDEIRKVLRAPNKRVIRATRKLNPLTNNKAMLKLNPY 363 NLP ++ + D LLK + R P R RA K NPL N ML+LNPY Sbjct: 220 NLPGVELQHVDRLNLLKLCPGGHLGR-PKAR--RAIHKKNPLKNLGTMLRLNPY 270 >SB_54601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1718 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/49 (28%), Positives = 29/49 (59%) Frame = -3 Query: 551 TPSKQKKNFNLPQPKMANTDLTRLLKSDEIRKVLRAPNKRVIRATRKLN 405 TP++Q F + +++N D++RL S+ + ++ N RVI+++ N Sbjct: 802 TPTEQDAEFTANEAEVSNQDISRLSSSEPSPIIPKSINNRVIKSSALSN 850 >SB_14316| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1472 Score = 29.1 bits (62), Expect = 4.4 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 3/38 (7%) Frame = -3 Query: 476 KSDEIRKVLRAPNKRV---IRATRKLNPLTNNKAMLKL 372 +SD I K+ NK++ ++ L+ LTNNKA LKL Sbjct: 27 QSDVIHKIPNEANKQIGLRVKCLALLDYLTNNKAQLKL 64 >SB_23951| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 28.7 bits (61), Expect = 5.8 Identities = 21/67 (31%), Positives = 30/67 (44%), Gaps = 1/67 (1%) Frame = -1 Query: 613 VSSSGLSPHSAGLTPYSGHGRHHRNKRRTSTCPSQR-WPTLTSHVFSSLMRSGRSSVLPT 437 + SS L+ H+ G+ GHGR + C SQ WP + S + G + LPT Sbjct: 36 IYSSVLAAHNRGVIFDVGHGRGSFSWTVAELCASQDFWPDVISTDLHVDCQKGPAYDLPT 95 Query: 436 NA*SVLH 416 +LH Sbjct: 96 VMTKMLH 102 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,489,828 Number of Sequences: 59808 Number of extensions: 313267 Number of successful extensions: 919 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 824 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 918 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2203769656 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -