BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_D18 (800 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g54020.2 68414.m06155 myrosinase-associated protein, putative... 31 0.89 At5g18830.2 68418.m02238 squamosa promoter-binding protein-like ... 30 1.6 At3g44800.1 68416.m04826 meprin and TRAF homology domain-contain... 30 1.6 At3g53440.2 68416.m05898 expressed protein 30 2.1 At3g53440.1 68416.m05897 expressed protein 30 2.1 At1g35510.1 68414.m04407 expressed protein contains Pfam PF03138... 30 2.1 At5g41150.1 68418.m05002 repair endonuclease (RAD1) (UVH1) conta... 29 3.6 At5g65770.1 68418.m08276 nuclear matrix constituent protein-rela... 29 4.7 At3g52160.1 68416.m05726 beta-ketoacyl-CoA synthase family prote... 29 4.7 At1g64340.1 68414.m07291 hypothetical protein 28 8.3 >At1g54020.2 68414.m06155 myrosinase-associated protein, putative strong similarity to myrosinase-associated proteins GI:1769968, GI:1769970, GI:1216389,GI:1216391 from [Brassica napus]; contains InterPro Entry IPR001087 Lipolytic enzyme, G-D-S-L family Length = 372 Score = 31.1 bits (67), Expect = 0.89 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = -1 Query: 665 LACGSQAFIATLLFDPSMSALPIIAKQNSPSVGLFT 558 + C S + + LL P + L I+ QN P+VGLFT Sbjct: 1 MECSSVSVLGILLVFPLLHNLVTISGQNLPAVGLFT 36 >At5g18830.2 68418.m02238 squamosa promoter-binding protein-like 7 (SPL7) identical to squamosa promoter binding protein-like 7 [Arabidopsis thaliana] GI:5931635; contains Pfam profile PF03110: SBP domain Length = 775 Score = 30.3 bits (65), Expect = 1.6 Identities = 18/68 (26%), Positives = 31/68 (45%), Gaps = 1/68 (1%) Frame = -3 Query: 528 TVVRQVSFTLLMACRCDSNTAQYERNRSFGHLVHALGRAAGGAKLPSAGL-CLNASKAEA 352 T+V+++ L+ C CD + N +H ++ +K P AGL C +A+ Sbjct: 632 TLVKKMEPDSLVHCTCDCDVRLLHENMDLASDIHRKHQSPIESKDPEAGLDCKERIQADC 691 Query: 351 SLAESGKD 328 S GK+ Sbjct: 692 SPDSGGKE 699 >At3g44800.1 68416.m04826 meprin and TRAF homology domain-containing protein / MATH domain-containing protein Length = 564 Score = 30.3 bits (65), Expect = 1.6 Identities = 18/58 (31%), Positives = 30/58 (51%) Frame = +2 Query: 113 KSSTDYSEPRHRTELYPDLRSRDARVKKKTDSIDLRDPNGLRRRVSRFECETRLVKSH 286 K S + +PR R LY D + + + K+T S+D+ NG + S+ E R+ + H Sbjct: 142 KESQEVIKPRKRMRLYGDGGAVSSHLHKETSSVDV---NGFQVLPSQAESVKRIFERH 196 >At3g53440.2 68416.m05898 expressed protein Length = 512 Score = 29.9 bits (64), Expect = 2.1 Identities = 23/74 (31%), Positives = 34/74 (45%) Frame = +2 Query: 110 RKSSTDYSEPRHRTELYPDLRSRDARVKKKTDSIDLRDPNGLRRRVSRFECETRLVKSHC 289 RKS+ +P R+ L++RD++VK + D +P RR RLV S Sbjct: 4 RKSTVVLPQPIRRSARLISLQNRDSQVKPRKDLGFGSEPTKKTRREVLRGLSKRLVYSSD 63 Query: 290 LEPPDSRGSTVSIS 331 DSR ++IS Sbjct: 64 SPIEDSRSKKLNIS 77 >At3g53440.1 68416.m05897 expressed protein Length = 512 Score = 29.9 bits (64), Expect = 2.1 Identities = 23/74 (31%), Positives = 34/74 (45%) Frame = +2 Query: 110 RKSSTDYSEPRHRTELYPDLRSRDARVKKKTDSIDLRDPNGLRRRVSRFECETRLVKSHC 289 RKS+ +P R+ L++RD++VK + D +P RR RLV S Sbjct: 4 RKSTVVLPQPIRRSARLISLQNRDSQVKPRKDLGFGSEPTKKTRREVLRGLSKRLVYSSD 63 Query: 290 LEPPDSRGSTVSIS 331 DSR ++IS Sbjct: 64 SPIEDSRSKKLNIS 77 >At1g35510.1 68414.m04407 expressed protein contains Pfam PF03138: Plant protein family. The function of this family of plant proteins is unknown; previously annotated as 'growth regulator protein -related' based on similarity to axi 1 protein (GB:X80301) (GI:559920) from [Nicotiana tabacum], which, due to scienitific fraud was retracted. Retraction in: Schell J. EMBO J 1999 May 17;18(10):2908. PMID:10400497. Length = 568 Score = 29.9 bits (64), Expect = 2.1 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +1 Query: 607 ADIEGSKSNVAMNAWLPQASYPW 675 AD+ GS NV M AW P+ W Sbjct: 122 ADVNGSSHNVLMEAWKPRVKSVW 144 >At5g41150.1 68418.m05002 repair endonuclease (RAD1) (UVH1) contains Pfam PF02732 : ERCC4 domain; contains TIGRFAM TIGR00596: DNA repair protein (rad1); almost identical to 5' repair endonuclease (GI:8926611) [Arabidopsis thaliana] Length = 956 Score = 29.1 bits (62), Expect = 3.6 Identities = 25/102 (24%), Positives = 43/102 (42%), Gaps = 2/102 (1%) Frame = +2 Query: 47 GLSLNRSQHDAALPSTTPRQERKSSTDYSEPRHRTELYPDLRSRDARVKKKTDSIDLRDP 226 G S+ R +H+A + + + ++ +TD + + E + D S KK DP Sbjct: 492 GSSVGRQEHEALMAAASSIRKLGKTTDMASGNNNPEPHVDKASCTKGKAKK-------DP 544 Query: 227 NGLRRRVSRFECETRLVKSHCLEPPDS--RGSTVSISLPDSA 346 LRR + +T K L P++ + + S S P A Sbjct: 545 TSLRRSLRSCNKKTTNSKPEILPGPENEEKANEASTSAPQEA 586 >At5g65770.1 68418.m08276 nuclear matrix constituent protein-related low similarity to nuclear matrix constituent protein 1 (NMCP1) [Daucus carota] GI:2190187 Length = 1042 Score = 28.7 bits (61), Expect = 4.7 Identities = 22/74 (29%), Positives = 36/74 (48%) Frame = +2 Query: 104 QERKSSTDYSEPRHRTELYPDLRSRDARVKKKTDSIDLRDPNGLRRRVSRFECETRLVKS 283 +E K+S D S+ H E + S A KK+ +S+ +D + +S E +++ Sbjct: 95 EEIKASVDESDLTHMREKSAYV-SALAEAKKREESLK-KDVGIAKECISSLEKTLHEMRA 152 Query: 284 HCLEPPDSRGSTVS 325 C E S GST+S Sbjct: 153 ECAETKVSAGSTMS 166 >At3g52160.1 68416.m05726 beta-ketoacyl-CoA synthase family protein beta-ketoacyl-CoA synthase - Simmondsia chinensis,PID:g1045614 Length = 451 Score = 28.7 bits (61), Expect = 4.7 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -3 Query: 789 RAKAGLIQMFSTHRDCESTAYRSFSIK 709 RAK L+Q+ TH+ E T+Y+S ++ Sbjct: 291 RAKYQLMQLVRTHKGMEDTSYKSIELR 317 >At1g64340.1 68414.m07291 hypothetical protein Length = 265 Score = 27.9 bits (59), Expect = 8.3 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = -3 Query: 747 DCESTAYRSFSIKSF*QEVPEKLPPGITGLWQPSVHS 637 DCEST Y SF + SF +++ + + P + S Sbjct: 124 DCESTLYDSFELNSFNRQLNSAISSSARSMSMPHLSS 160 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,735,982 Number of Sequences: 28952 Number of extensions: 379577 Number of successful extensions: 950 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 928 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 950 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1814318400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -