BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_D17 (820 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 24 4.9 AY745220-1|AAU93487.1| 101|Anopheles gambiae cytochrome P450 pr... 23 8.6 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 24.2 bits (50), Expect = 4.9 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 51 FYNITSQEHGTSIRGRGCSMDPLDC 125 F NITS+ ++ + C+ D LDC Sbjct: 930 FINITSKCTASTTCKKNCASDELDC 954 >AY745220-1|AAU93487.1| 101|Anopheles gambiae cytochrome P450 protein. Length = 101 Score = 23.4 bits (48), Expect = 8.6 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +2 Query: 62 YVPGARHFHPRSWLQYGSLRL*KDRVGAGQK 154 Y P F P WL+ G L+ AGQK Sbjct: 12 YFPEPDRFVPERWLKRGELKEHSGCPHAGQK 42 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 300,289 Number of Sequences: 2352 Number of extensions: 3323 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 86902827 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -