BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_D13 (776 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014134-884|AAF52222.1| 299|Drosophila melanogaster CG14035-PA... 32 1.0 AE014296-3425|AAF51645.2| 926|Drosophila melanogaster CG3680-PA... 30 4.1 >AE014134-884|AAF52222.1| 299|Drosophila melanogaster CG14035-PA protein. Length = 299 Score = 31.9 bits (69), Expect = 1.0 Identities = 19/70 (27%), Positives = 29/70 (41%), Gaps = 1/70 (1%) Frame = -1 Query: 707 SSTXPXXXXTSTRSSNPRFHTPTTPDLTSISINPLTPX*KEFAPGLKPPLSSEAPSAY-L 531 S P R NPR H P +P +S P +P AP P +S P + + Sbjct: 2 SGQQPPPYGNGPRGWNPRAHNPASPSPSSFLYRPPSPW--TTAPSPPPIISGPRPYGHAM 59 Query: 530 TPSSLGMXKG 501 +P+ + +G Sbjct: 60 SPAPINQVRG 69 >AE014296-3425|AAF51645.2| 926|Drosophila melanogaster CG3680-PA protein. Length = 926 Score = 29.9 bits (64), Expect = 4.1 Identities = 22/62 (35%), Positives = 30/62 (48%) Frame = -1 Query: 677 STRSSNPRFHTPTTPDLTSISINPLTPX*KEFAPGLKPPLSSEAPSAYLTPSSLGMXKGV 498 ST+++ P PTTP T SI+P T KE AP + + + TP G +G Sbjct: 405 STKAACP---APTTPKTTVKSISPTTTTKKEVAPKKRSATPTARSTKAGTPVG-GTERGP 460 Query: 497 SP 492 SP Sbjct: 461 SP 462 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 30,991,485 Number of Sequences: 53049 Number of extensions: 644713 Number of successful extensions: 2013 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1923 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2011 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3602427675 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -