BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_D13 (776 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g47170.1 68416.m05122 transferase family protein low similari... 35 0.069 At2g24980.1 68415.m02987 proline-rich extensin-like family prote... 35 0.069 At5g06630.1 68418.m00749 proline-rich extensin-like family prote... 32 0.37 At3g24550.1 68416.m03083 protein kinase family protein contains ... 32 0.37 At2g28440.1 68415.m03455 proline-rich family protein contains pr... 30 2.0 At2g42460.1 68415.m05253 meprin and TRAF homology domain-contain... 29 2.6 At4g35800.1 68417.m05087 DNA-directed RNA polymerase II largest ... 29 3.4 At4g29990.1 68417.m04266 light repressible receptor protein kina... 29 3.4 At3g47590.1 68416.m05181 esterase/lipase/thioesterase family pro... 29 3.4 At4g20200.1 68417.m02953 terpene synthase/cyclase family protein... 29 4.5 At1g61520.1 68414.m06931 chlorophyll A-B binding protein / LHCI ... 29 4.5 At5g49080.1 68418.m06074 proline-rich extensin-like family prote... 28 6.0 At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacy... 28 7.9 At1g06170.2 68414.m00649 basic helix-loop-helix (bHLH) family pr... 28 7.9 At1g06170.1 68414.m00648 basic helix-loop-helix (bHLH) family pr... 28 7.9 >At3g47170.1 68416.m05122 transferase family protein low similarity to 10-deacetylbaccatin III-10-O-acetyl transferase Taxus cuspidata GI:6746554; contains Pfam profile PF02458 transferase family Length = 468 Score = 34.7 bits (76), Expect = 0.069 Identities = 21/75 (28%), Positives = 37/75 (49%), Gaps = 2/75 (2%) Frame = -2 Query: 469 NHKLRALLVVIPRILRSPP-PTHPLIEDVVMATNQAIIDYK-VKIADNNLVTHKELALKV 296 N K LV + + SP PT ++ +++ T++ I K + I D NL KE +K+ Sbjct: 222 NDKNNPKLVDVEKDCSSPDTPTEDMVREILNITSEDITKLKNIIIEDENLTNEKEKNMKI 281 Query: 295 SSIIGTRVYVFDPSC 251 +++ YV+ C Sbjct: 282 TTVEVLAAYVWRARC 296 >At2g24980.1 68415.m02987 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 559 Score = 34.7 bits (76), Expect = 0.069 Identities = 23/64 (35%), Positives = 30/64 (46%) Frame = -1 Query: 677 STRSSNPRFHTPTTPDLTSISINPLTPX*KEFAPGLKPPLSSEAPSAYLTPSSLGMXKGV 498 +T +S P + +P TP S S P ++AP KP + S P Y TPS K Sbjct: 18 ATVTSYP-YSSPQTPSYNSPSYEHKGP---KYAPHPKPYVKSSPPPQYYTPSPKVNYKSP 73 Query: 497 SPPY 486 PPY Sbjct: 74 PPPY 77 >At5g06630.1 68418.m00749 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 440 Score = 32.3 bits (70), Expect = 0.37 Identities = 23/64 (35%), Positives = 30/64 (46%) Frame = -1 Query: 677 STRSSNPRFHTPTTPDLTSISINPLTPX*KEFAPGLKPPLSSEAPSAYLTPSSLGMXKGV 498 +T +S P + +P TP S S P ++AP KP + S P Y TPS K Sbjct: 24 ATVTSYP-YSSPHTPAYDSPSYEHKGP---KYAPHPKPYVYSSPPPPYYTPSPKVNYKSP 79 Query: 497 SPPY 486 PPY Sbjct: 80 PPPY 83 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 32.3 bits (70), Expect = 0.37 Identities = 26/67 (38%), Positives = 34/67 (50%), Gaps = 2/67 (2%) Frame = -1 Query: 716 PXASSTXPXXXXTSTRSSNPRFHTPTTPDLTSISINPLTPX*KEFAP--GLKPPLSSEAP 543 P ASS P T+T SS P +P+T + +PL P +P L PPL +P Sbjct: 29 PAASSPPP----TTTPSSPPP--SPSTNSTSPPPSSPLPPSLPPPSPPGSLTPPLPQPSP 82 Query: 542 SAYLTPS 522 SA +TPS Sbjct: 83 SAPITPS 89 >At2g28440.1 68415.m03455 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains similarity to vegetative cell wall protein gp1 [Chlamydomonas reinhardtii] gi|12018147|gb|AAG45420; + Length = 268 Score = 29.9 bits (64), Expect = 2.0 Identities = 23/86 (26%), Positives = 31/86 (36%) Frame = -1 Query: 716 PXASSTXPXXXXTSTRSSNPRFHTPTTPDLTSISINPLTPX*KEFAPGLKPPLSSEAPSA 537 P + S+ P SS+P +P P + +PL P +PP SS + Sbjct: 56 PLSPSSSPEEDSPLPPSSSPEEDSPLAPSSSPEVDSPLAPSSSPEVDSPQPPSSSPEADS 115 Query: 536 YLTPSSLGMXKGVSPPYFQVNDESQA 459 L PSS P ES A Sbjct: 116 PLPPSSSPEANSPQSPASSPKPESLA 141 >At2g42460.1 68415.m05253 meprin and TRAF homology domain-containing protein / MATH domain-containing protein weak similarity to ubiquitin-specific protease 12 [Arabidopsis thaliana] GI:11993471; contains Pfam profile PF00917: MATH domain Length = 441 Score = 29.5 bits (63), Expect = 2.6 Identities = 15/45 (33%), Positives = 25/45 (55%) Frame = -2 Query: 442 VIPRILRSPPPTHPLIEDVVMATNQAIIDYKVKIADNNLVTHKEL 308 V P++L PL E+ + N+ II +VK+A+ +T KE+ Sbjct: 273 VEPKMLSFKDYASPLQEEGFLENNKLIIRVEVKVAEEGYLTGKEM 317 >At4g35800.1 68417.m05087 DNA-directed RNA polymerase II largest subunit (RPB205) (RPII) (RPB1) nearly identical to P|P18616 DNA-directed RNA polymerase II largest subunit (EC 2.7.7.6) {Arabidopsis thaliana} Length = 1840 Score = 29.1 bits (62), Expect = 3.4 Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 3/69 (4%) Frame = -1 Query: 716 PXASSTXPXXXXTS-TRSSNPRFHTPTTPDL--TSISINPLTPX*KEFAPGLKPPLSSEA 546 P S T P TS + S ++PT+P TS S +P +P +P P + + Sbjct: 1676 PSYSPTSPSYSPTSPSYSPTSPAYSPTSPGYSPTSPSYSPTSPSYGPTSPSYNPQSAKYS 1735 Query: 545 PSAYLTPSS 519 PS +PS+ Sbjct: 1736 PSIAYSPSN 1744 >At4g29990.1 68417.m04266 light repressible receptor protein kinase identical to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376 Length = 876 Score = 29.1 bits (62), Expect = 3.4 Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 1/60 (1%) Frame = -2 Query: 289 IIGTRVYVFDPSCYFSTPPFDTVLYDNI-RTVLKDNKTALLSASIQASLPSSEIYRQLVD 113 +I TR + + TP FD + N+ +V+ N+TA+++ I + PS I+ LVD Sbjct: 104 LIRTRFMYGNYDGFSKTPEFDLYIGANLWESVVLINETAIMTKEIIYTPPSDHIHVCLVD 163 >At3g47590.1 68416.m05181 esterase/lipase/thioesterase family protein low similarity to cinnamoyl ester hydrolase CinI [Butyrivibrio fibrisolvens] GI:1622732; contains Interpro entry IPR000379 Length = 309 Score = 29.1 bits (62), Expect = 3.4 Identities = 16/52 (30%), Positives = 25/52 (48%) Frame = -2 Query: 271 YVFDPSCYFSTPPFDTVLYDNIRTVLKDNKTALLSASIQASLPSSEIYRQLV 116 +V S Y+ T PF T + N+R +K+N+ + A PS I Q + Sbjct: 10 FVPQDSPYYKTSPFPTSSFFNVRFPIKNNQISCNKAKNLRMDPSKGIQEQRI 61 >At4g20200.1 68417.m02953 terpene synthase/cyclase family protein 5-epi-aristolochene synthase, Nicotiana tabacum, PATX:G505588 Length = 604 Score = 28.7 bits (61), Expect = 4.5 Identities = 18/51 (35%), Positives = 24/51 (47%) Frame = +2 Query: 134 LGGRERSLNRCREKSSFVVLKNRPDVVVQYGIEGRS*KVARGIEDVDSGAY 286 L G S+ + K +F LK+RP +V I+GR G ED S Y Sbjct: 464 LAGIFMSMGKMATKEAFEWLKSRPKLVQYLSIKGRLMNDLMGYEDDMSRGY 514 >At1g61520.1 68414.m06931 chlorophyll A-B binding protein / LHCI type III (LHCA3.1) nearly identical to PSI type III chlorophyll a/b-binding protein GI:430947; contains Pfam profile: PF00504 chlorophyll A-B binding protein; similar to PSI type III chlorophyll a/b-binding protein GI:430947 from [Arabidopsis thaliana] Length = 273 Score = 28.7 bits (61), Expect = 4.5 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = +1 Query: 484 K*GGETPLXMPSDEGVRYADGASDDNGGFNPGANSFXYGVRGLME 618 K G PL S + + Y DG+ + GF+P S G G +E Sbjct: 48 KQGANRPLWFASSQSLSYLDGSLPGDYGFDPLGLSDPEGTGGFIE 92 >At5g49080.1 68418.m06074 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 609 Score = 28.3 bits (60), Expect = 6.0 Identities = 19/64 (29%), Positives = 29/64 (45%) Frame = -1 Query: 677 STRSSNPRFHTPTTPDLTSISINPLTPX*KEFAPGLKPPLSSEAPSAYLTPSSLGMXKGV 498 +T +S P + +P TP S +P ++ P KP + + P Y +PS K Sbjct: 18 ATVTSYP-YSSPQTPQYNFPSHQHKSP---KYTPHSKPYIYNSPPPPYYSPSPKVNYKSP 73 Query: 497 SPPY 486 PPY Sbjct: 74 PPPY 77 >At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacyanin 3 GI:3395770 from [Arabidopsis thaliana]; contains Pfam profile PF02298: Plastocyanin-like domain; identical to cDNA uclacyanin 3 (UCC3)GI:3395769 Length = 222 Score = 27.9 bits (59), Expect = 7.9 Identities = 22/82 (26%), Positives = 30/82 (36%), Gaps = 2/82 (2%) Frame = -1 Query: 731 IXGVXPXASSTXPXXXXTSTRSSNPRFHTPTTPDLTSISINPLTPX*--KEFAPGLKPPL 558 + P S+ ST SS P TP+TP +P +P P PP Sbjct: 118 VLAAAPSPSTPSSPPSTPSTPSSPPS--TPSTPSSPPSPPSPPSPSLPPSSLPPSASPPT 175 Query: 557 SSEAPSAYLTPSSLGMXKGVSP 492 + S LTP + +SP Sbjct: 176 NGTPDSETLTPPPAPLPPSLSP 197 >At1g06170.2 68414.m00649 basic helix-loop-helix (bHLH) family protein contains Pfam profile:PF00010 helix-loop-helix DNA-binding domain Length = 420 Score = 27.9 bits (59), Expect = 7.9 Identities = 18/70 (25%), Positives = 33/70 (47%), Gaps = 5/70 (7%) Frame = -2 Query: 547 LHQRISPPRHWA----WXKGFRPLIFK*MMNHKLRALLVVIPRILRSPPP-THPLIEDVV 383 +HQ + P + W G++ + NH LL ++ S PP +P I+D++ Sbjct: 91 MHQTLQDPSYAQQSNHWDNGYQDFV-NLGPNHTTPDLLSLLQLPRSSLPPFANPSIQDII 149 Query: 382 MATNQAIIDY 353 M T+ ++ Y Sbjct: 150 MTTSSSVAAY 159 >At1g06170.1 68414.m00648 basic helix-loop-helix (bHLH) family protein contains Pfam profile:PF00010 helix-loop-helix DNA-binding domain Length = 420 Score = 27.9 bits (59), Expect = 7.9 Identities = 18/70 (25%), Positives = 33/70 (47%), Gaps = 5/70 (7%) Frame = -2 Query: 547 LHQRISPPRHWA----WXKGFRPLIFK*MMNHKLRALLVVIPRILRSPPP-THPLIEDVV 383 +HQ + P + W G++ + NH LL ++ S PP +P I+D++ Sbjct: 91 MHQTLQDPSYAQQSNHWDNGYQDFV-NLGPNHTTPDLLSLLQLPRSSLPPFANPSIQDII 149 Query: 382 MATNQAIIDY 353 M T+ ++ Y Sbjct: 150 MTTSSSVAAY 159 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,005,200 Number of Sequences: 28952 Number of extensions: 312931 Number of successful extensions: 1110 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 871 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1091 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1736283200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -