BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_C23 (860 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF399825-1|AAK77200.1| 1262|Caenorhabditis elegans separase prot... 28 9.8 AC024791-1|AAF60651.1| 1262|Caenorhabditis elegans Separase prot... 28 9.8 >AF399825-1|AAK77200.1| 1262|Caenorhabditis elegans separase protein. Length = 1262 Score = 27.9 bits (59), Expect = 9.8 Identities = 16/52 (30%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = +2 Query: 5 FFFFYNGXXVXCXKCAFDN-DLRPS*HGTSIRVSWLQY-GSLTL*KDRGRTW 154 FF+FYNG C D DL + WL + G L + + +TW Sbjct: 120 FFYFYNGELCRAVVCLLDYIDLSDDTLAKEAALRWLMFLGETELIEKKLKTW 171 >AC024791-1|AAF60651.1| 1262|Caenorhabditis elegans Separase protein 1 protein. Length = 1262 Score = 27.9 bits (59), Expect = 9.8 Identities = 16/52 (30%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = +2 Query: 5 FFFFYNGXXVXCXKCAFDN-DLRPS*HGTSIRVSWLQY-GSLTL*KDRGRTW 154 FF+FYNG C D DL + WL + G L + + +TW Sbjct: 120 FFYFYNGELCRAVVCLLDYIDLSDDTLAKEAALRWLMFLGETELIEKKLKTW 171 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,885,129 Number of Sequences: 27780 Number of extensions: 111404 Number of successful extensions: 168 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 168 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 168 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2150453690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -