BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_C06 (806 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 23 2.2 EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B pro... 21 8.7 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 21 8.7 AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory recept... 21 8.7 AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory recept... 21 8.7 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 23.4 bits (48), Expect = 2.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 380 LSTATISIRSSWRIPYSPNFVEARFVAQY 466 L +T SI +SW+ P PN + + Y Sbjct: 1210 LVMSTDSILASWKPPVEPNGIVEYYTVYY 1238 >EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B protein. Length = 279 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +2 Query: 296 TKVNVLKPKTPRPS 337 TKV+ KP+ PRP+ Sbjct: 258 TKVSRRKPRPPRPT 271 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 21.4 bits (43), Expect = 8.7 Identities = 5/11 (45%), Positives = 10/11 (90%) Frame = -3 Query: 84 CKIWFLCESER 52 C+++++CE ER Sbjct: 931 CRMYYMCEGER 941 >AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory receptor candidate 9 protein. Length = 408 Score = 21.4 bits (43), Expect = 8.7 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 4/39 (10%) Frame = -2 Query: 502 PYPDDPGLNVGQ----ILSNEPGFYKVRGIRNSPRRSNR 398 P P D L+ IL+ GF+ V+G+R RS R Sbjct: 9 PVPGDKNLHKSYSKMLILAQIFGFFPVQGVRGPDFRSLR 47 >AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory receptor candidate 2 protein. Length = 587 Score = 21.4 bits (43), Expect = 8.7 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 4/39 (10%) Frame = -2 Query: 502 PYPDDPGLNVGQ----ILSNEPGFYKVRGIRNSPRRSNR 398 P P D L+ IL+ GF+ V+G+R RS R Sbjct: 9 PVPGDKNLHKSYSKMLILAQIFGFFPVQGVRGPDFRSLR 47 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,622 Number of Sequences: 336 Number of extensions: 3537 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21999028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -