BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_B23 (839 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47663| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.2 SB_5182| Best HMM Match : TSP_1 (HMM E-Value=1.1e-11) 28 8.2 >SB_47663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1409 Score = 28.7 bits (61), Expect = 6.2 Identities = 10/44 (22%), Positives = 21/44 (47%) Frame = -2 Query: 766 DXQWXXNGXRDXQKNIQYVXQRXGWDGSSSAVQRPXPWRGEARV 635 D + + Q N++ V + W+ S S +++ PW A++ Sbjct: 736 DRSYTFTATNNAQSNVELVKKFDNWEYSDSGIEKRMPWISGAKL 779 >SB_5182| Best HMM Match : TSP_1 (HMM E-Value=1.1e-11) Length = 1417 Score = 28.3 bits (60), Expect = 8.2 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = -2 Query: 730 QKNIQYVXQRXGWDGSSSAVQRPXPWRGEAR 638 Q N++ + + W + A+Q PW G A+ Sbjct: 1181 QTNVKLINKLGDWKNNKDAIQNRMPWLGSAK 1211 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,477,752 Number of Sequences: 59808 Number of extensions: 159563 Number of successful extensions: 297 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 277 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 297 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2371447782 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -