BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_B17 (819 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory recept... 28 0.10 AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory recept... 28 0.10 AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. 23 3.9 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 23 3.9 AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH trans... 22 6.7 >AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory receptor candidate 49 protein. Length = 418 Score = 27.9 bits (59), Expect = 0.10 Identities = 15/40 (37%), Positives = 18/40 (45%) Frame = -2 Query: 662 LLVDTPPFERAQRHRLDSETVVHRIWNNINSNLSNDARLR 543 LLV F R Q+ + T VH IWN D R+R Sbjct: 331 LLVMVAMFSRTQQSANKTATFVHEIWNKYALKNEVDKRVR 370 >AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory receptor candidate 14 protein. Length = 374 Score = 27.9 bits (59), Expect = 0.10 Identities = 15/40 (37%), Positives = 18/40 (45%) Frame = -2 Query: 662 LLVDTPPFERAQRHRLDSETVVHRIWNNINSNLSNDARLR 543 LLV F R Q+ + T VH IWN D R+R Sbjct: 287 LLVMVAMFSRTQQSANKTATFVHEIWNKYALKNEVDKRVR 326 >AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. Length = 209 Score = 22.6 bits (46), Expect = 3.9 Identities = 8/30 (26%), Positives = 15/30 (50%) Frame = -2 Query: 335 DDVKYESTIGPMTSTALLDNKMDVTDENVL 246 DDV+ T GP++ +D +D + + Sbjct: 87 DDVRSPGTPGPLSQAPASQQSLDASDPDAM 116 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 22.6 bits (46), Expect = 3.9 Identities = 8/30 (26%), Positives = 15/30 (50%) Frame = -2 Query: 335 DDVKYESTIGPMTSTALLDNKMDVTDENVL 246 DDV+ T GP++ +D +D + + Sbjct: 243 DDVRSPGTPGPLSQAPASQQSLDASDPDAM 272 >AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH transcription factor protein. Length = 193 Score = 21.8 bits (44), Expect = 6.7 Identities = 15/66 (22%), Positives = 27/66 (40%) Frame = -2 Query: 728 RRYLXAVEERXPTPGVRHGLARLLVDTPPFERAQRHRLDSETVVHRIWNNINSNLSNDAR 549 +R + V ER T + A L P + ++ + + R + + LSN+ Sbjct: 97 QRVMANVRERQRTQSLNEAFASLRKSIPTMPSDKLSKIQTLKLAARYIDFLYHVLSNENA 156 Query: 548 LRCDLV 531 L DL+ Sbjct: 157 LDVDLI 162 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,460 Number of Sequences: 336 Number of extensions: 3197 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22414104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -