Silkworm BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdV10417
         (839 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q77NK4 Cluster: Bcl-2 homolog; n=3; Cercopithecine herp...    37   0.72 

>UniRef50_Q77NK4 Cluster: Bcl-2 homolog; n=3; Cercopithecine
           herpesvirus 17|Rep: Bcl-2 homolog - Rhesus monkey
           rhadinovirus H26-95
          Length = 187

 Score = 36.7 bits (81), Expect = 0.72
 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 1/45 (2%)
 Frame = -3

Query: 810 PPNHEAEVSV-VSVYCIRSSRSYCNLNKFEFLHFPIFVHFHKYLT 679
           PP  E E S+ V VY I     YC L + E+LH P+F    ++++
Sbjct: 10  PPEEENENSLPVDVYAIEGIFLYCGLGQAEYLHHPVFSPIKEFIS 54


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 694,781,515
Number of Sequences: 1657284
Number of extensions: 12579166
Number of successful extensions: 25691
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 24851
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 25688
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 73373641369
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)