SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30049
         (727 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q4T4A9 Cluster: Chromosome undetermined SCAF9757, whole...   113   6e-24
UniRef50_Q14240 Cluster: Eukaryotic initiation factor 4A-II; n=3...   109   7e-23
UniRef50_Q4SP80 Cluster: Chromosome 15 SCAF14542, whole genome s...   107   4e-22
UniRef50_P38919 Cluster: Eukaryotic initiation factor 4A-III; n=...   106   6e-22
UniRef50_A5BYF4 Cluster: Putative uncharacterized protein; n=1; ...    91   2e-17
UniRef50_A0D232 Cluster: Chromosome undetermined scaffold_35, wh...    89   8e-17
UniRef50_A2AAP7 Cluster: DEAD (Asp-Glu-Ala-Asp) box polypeptide ...    89   1e-16
UniRef50_UPI000065E01D Cluster: Homolog of Brachydanio rerio "Eu...    86   1e-15
UniRef50_A5BNE7 Cluster: Putative uncharacterized protein; n=1; ...    75   2e-12
UniRef50_A7P4J7 Cluster: Chromosome chr4 scaffold_6, whole genom...    74   3e-12
UniRef50_Q8SQM5 Cluster: ATP-dependent RNA helicase eIF4A; n=1; ...    74   4e-12
UniRef50_UPI0000F2BC8C Cluster: PREDICTED: similar to eukaryotic...    66   6e-10
UniRef50_A0BEU9 Cluster: Chromosome undetermined scaffold_102, w...    66   8e-10
UniRef50_P39517 Cluster: ATP-dependent RNA helicase DHH1; n=103;...    66   1e-09
UniRef50_Q0E2Q3 Cluster: Putative eukaryotic initiation factor 4...    65   1e-09
UniRef50_Q8SSD2 Cluster: ATP-DEPENDENT RNA HELICASE INVOLVED IN ...    64   4e-09
UniRef50_Q5KJI2 Cluster: ATP-dependent RNA helicase DHH1; n=4; D...    64   4e-09
UniRef50_Q725W5 Cluster: ATP-dependent RNA helicase, DEAD/DEAH f...    62   2e-08
UniRef50_Q54TF8 Cluster: DEAD-box RNA helicase; n=2; Dictyosteli...    62   2e-08
UniRef50_Q5BXU1 Cluster: SJCHGC08663 protein; n=1; Schistosoma j...    61   2e-08
UniRef50_Q9UHL0 Cluster: ATP-dependent RNA helicase DDX25; n=111...    61   2e-08
UniRef50_A4V6K5 Cluster: DEAD box polypeptide 19 protein; n=3; P...    61   3e-08
UniRef50_Q8XKJ8 Cluster: ATP-dependent RNA helicase; n=12; Clost...    60   4e-08
UniRef50_Q4T821 Cluster: Chromosome undetermined SCAF7914, whole...    59   1e-07
UniRef50_Q8IV96 Cluster: DDX6 protein; n=8; Eukaryota|Rep: DDX6 ...    59   1e-07
UniRef50_Q7QTB2 Cluster: GLP_15_13424_14974; n=2; Giardia intest...    59   1e-07
UniRef50_UPI0001509D93 Cluster: DEAD/DEAH box helicase family pr...    58   2e-07
UniRef50_Q67NW1 Cluster: ATP-dependent RNA helicase; n=5; Firmic...    58   2e-07
UniRef50_A2DVG1 Cluster: DEAD/DEAH box helicase family protein; ...    58   2e-07
UniRef50_P20449 Cluster: ATP-dependent RNA helicase DBP5; n=23; ...    58   3e-07
UniRef50_Q893G8 Cluster: ATP-dependent RNA helicase; n=4; Clostr...    57   4e-07
UniRef50_Q11QF9 Cluster: Inducible ATP-independent RNA helicase;...    57   4e-07
UniRef50_A6NQG8 Cluster: Putative uncharacterized protein; n=2; ...    57   4e-07
UniRef50_Q23U16 Cluster: DEAD/DEAH box helicase family protein; ...    57   4e-07
UniRef50_UPI0000566899 Cluster: UPI0000566899 related cluster; n...    57   5e-07
UniRef50_Q4S6B9 Cluster: Chromosome 9 SCAF14729, whole genome sh...    56   7e-07
UniRef50_A5E6W6 Cluster: ATP-dependent rRNA helicase RRP3; n=4; ...    56   7e-07
UniRef50_Q5KBP5 Cluster: ATP-dependent RNA helicase DBP5; n=3; F...    56   7e-07
UniRef50_Q0RTL3 Cluster: Cold-shock DeaD box ATP-dependent RNA h...    56   9e-07
UniRef50_Q98RE0 Cluster: ATP-DEPENDENT RNA HELICASE; n=1; Mycopl...    56   1e-06
UniRef50_Q26CN9 Cluster: ATP-dependent RNA helicase; n=1; Flavob...    56   1e-06
UniRef50_A2EPG4 Cluster: DEAD/DEAH box helicase family protein; ...    56   1e-06
UniRef50_Q7VFA9 Cluster: ATP-dependent RNA helicase DeaD; n=6; H...    55   2e-06
UniRef50_P21507 Cluster: ATP-dependent RNA helicase srmB; n=82; ...    55   2e-06
UniRef50_Q6AMK6 Cluster: Probable ATP-dependent RNA helicase; n=...    55   2e-06
UniRef50_A7R616 Cluster: Chromosome undetermined scaffold_1128, ...    55   2e-06
UniRef50_P38712 Cluster: ATP-dependent rRNA helicase RRP3; n=6; ...    55   2e-06
UniRef50_Q9SW44 Cluster: DEAD-box ATP-dependent RNA helicase 16;...    55   2e-06
UniRef50_Q1IMK6 Cluster: DEAD/DEAH box helicase-like; n=1; Acido...    54   3e-06
UniRef50_P25888 Cluster: Putative ATP-dependent RNA helicase rhl...    54   3e-06
UniRef50_UPI00005A557C Cluster: PREDICTED: similar to eukaryotic...    54   4e-06
UniRef50_Q6F0U0 Cluster: ATP-dependent RNA helicase; n=1; Mesopl...    54   4e-06
UniRef50_Q1I3W1 Cluster: ATP-dependent RNA helicase RhlE, DEAD b...    54   4e-06
UniRef50_A4FZ46 Cluster: DEAD/DEAH box helicase domain protein; ...    54   4e-06
UniRef50_Q6MN50 Cluster: ATP-dependent RNA helicase; n=1; Bdello...    54   5e-06
UniRef50_A0Z0M4 Cluster: ATP-dependent RNA helicase; n=1; marine...    54   5e-06
UniRef50_A5B2H1 Cluster: Putative uncharacterized protein; n=1; ...    54   5e-06
UniRef50_Q8MYE9 Cluster: Similar to Mus musculus (Mouse). DEAD-b...    54   5e-06
UniRef50_Q16JA8 Cluster: DEAD box ATP-dependent RNA helicase; n=...    54   5e-06
UniRef50_Q9KAA6 Cluster: ATP-dependent RNA helicase; n=5; Firmic...    53   6e-06
UniRef50_Q03YT1 Cluster: Superfamily II DNA and RNA helicase; n=...    53   6e-06
UniRef50_A7U5W6 Cluster: DEAD-box helicase 1; n=8; Aconoidasida|...    53   6e-06
UniRef50_UPI00015B4D43 Cluster: PREDICTED: hypothetical protein;...    53   8e-06
UniRef50_Q7MT81 Cluster: ATP-dependent RNA helicase, DEAD/DEAH b...    53   8e-06
UniRef50_Q28T45 Cluster: DEAD/DEAH box helicase-like protein; n=...    53   8e-06
UniRef50_A2TP65 Cluster: ATP-dependent RNA helicase, DEAD/DEAH b...    53   8e-06
UniRef50_Q2WF63 Cluster: Putative uncharacterized protein; n=4; ...    53   8e-06
UniRef50_A2SQE1 Cluster: DEAD/DEAH box helicase domain protein; ...    53   8e-06
UniRef50_Q7UNV7 Cluster: ATP-dependent RNA helicase; n=2; Planct...    52   1e-05
UniRef50_Q9S531 Cluster: DEAD-box protein; n=4; Cystobacterineae...    52   1e-05
UniRef50_Q1MY97 Cluster: DEAD/DEAH box helicase-like protein; n=...    52   1e-05
UniRef50_Q188H5 Cluster: Putative ATP-dependent RNA helicase; n=...    52   1e-05
UniRef50_A7HDE9 Cluster: DEAD/DEAH box helicase domain protein; ...    52   1e-05
UniRef50_Q4Q2Z6 Cluster: ATP-dependent RNA helicase, putative; n...    52   1e-05
UniRef50_Q81VG0 Cluster: DEAD-box ATP-dependent RNA helicase ydb...    52   1e-05
UniRef50_UPI0000585111 Cluster: PREDICTED: hypothetical protein;...    52   1e-05
UniRef50_Q484Q1 Cluster: RNA helicase DeaD; n=1; Colwellia psych...    52   1e-05
UniRef50_A6Q8Y9 Cluster: ATP-dependent RNA helicase, DEAD-box fa...    52   1e-05
UniRef50_A6DL95 Cluster: Probable ATP-dependent RNA helicase; n=...    52   1e-05
UniRef50_P75172 Cluster: Probable ATP-dependent RNA helicase MG4...    52   1e-05
UniRef50_UPI0000D55AB0 Cluster: PREDICTED: similar to Probable A...    52   2e-05
UniRef50_A4C0F9 Cluster: ATP-dependent RNA helicase; n=6; Bacter...    52   2e-05
UniRef50_Q54VF1 Cluster: Putative uncharacterized protein; n=1; ...    52   2e-05
UniRef50_Q56XG6 Cluster: DEAD-box ATP-dependent RNA helicase 15;...    52   2e-05
UniRef50_Q8GY84 Cluster: DEAD-box ATP-dependent RNA helicase 10;...    52   2e-05
UniRef50_Q0UZ59 Cluster: ATP-dependent RNA helicase DBP9; n=1; P...    52   2e-05
UniRef50_Q8R4Z5 Cluster: DEAD-box corepressor DP103 beta; n=5; T...    51   3e-05
UniRef50_Q5GZA1 Cluster: ATP-dependent RNA helicase; n=6; Xantho...    51   3e-05
UniRef50_Q185X0 Cluster: ATP-dependent RNA helicase; n=3; Clostr...    51   3e-05
UniRef50_A6TX49 Cluster: DEAD/DEAH box helicase domain protein; ...    51   3e-05
UniRef50_A3J7I3 Cluster: ATP-independent RNA helicase; n=5; Bact...    51   3e-05
UniRef50_Q9SEV5 Cluster: RNA helicase; n=1; Guillardia theta|Rep...    51   3e-05
UniRef50_P44586 Cluster: Cold-shock DEAD box protein A homolog; ...    51   3e-05
UniRef50_Q9UHI6 Cluster: Probable ATP-dependent RNA helicase DDX...    51   3e-05
UniRef50_Q0TQ86 Cluster: ATP-dependent RNA helicase, DEAD/DEAH b...    51   3e-05
UniRef50_A7CSF3 Cluster: DEAD/DEAH box helicase domain protein; ...    51   3e-05
UniRef50_Q016I5 Cluster: Predicted ATP-dependent RNA helicase FA...    51   3e-05
UniRef50_A6PWH4 Cluster: HLA-B associated transcript 1; n=6; Hom...    51   3e-05
UniRef50_Q5L3G9 Cluster: DEAD-box ATP-dependent RNA helicase ydb...    51   3e-05
UniRef50_Q13838 Cluster: Spliceosome RNA helicase BAT1; n=55; Eu...    51   3e-05
UniRef50_P0A9P8 Cluster: Cold-shock DEAD box protein A; n=54; Ga...    51   3e-05
UniRef50_O00148 Cluster: ATP-dependent RNA helicase DDX39; n=27;...    51   3e-05
UniRef50_Q3AFI3 Cluster: ATP-dependent RNA helicase, DEAD box fa...    50   4e-05
UniRef50_Q1QYG3 Cluster: DEAD/DEAH box helicase-like protein; n=...    50   4e-05
UniRef50_A7BCL2 Cluster: Putative uncharacterized protein; n=1; ...    50   4e-05
UniRef50_A4J5M3 Cluster: DEAD/DEAH box helicase domain protein; ...    50   4e-05
UniRef50_A4EAF2 Cluster: Putative uncharacterized protein; n=1; ...    50   4e-05
UniRef50_Q0W8H7 Cluster: ATP-dependent RNA helicase; n=1; uncult...    50   4e-05
UniRef50_P0C218 Cluster: Probable ATP-dependent RNA helicase DDX...    50   4e-05
UniRef50_UPI00015B5D7B Cluster: PREDICTED: similar to LD28101p; ...    50   6e-05
UniRef50_Q62IF8 Cluster: ATP-dependent RNA helicase RhlE; n=59; ...    50   6e-05
UniRef50_Q0AVQ9 Cluster: ATP-dependent RNA helicase; n=1; Syntro...    50   6e-05
UniRef50_A6T3R2 Cluster: ATP-dependent RNA helicase; n=52; cellu...    50   6e-05
UniRef50_Q54TJ4 Cluster: Putative uncharacterized protein; n=1; ...    50   6e-05
UniRef50_Q6CHU3 Cluster: Similarities with sp|P38112 Saccharomyc...    50   6e-05
UniRef50_O26305 Cluster: ATP-dependent RNA helicase, eIF-4A fami...    50   6e-05
UniRef50_P96614 Cluster: DEAD-box ATP-dependent RNA helicase ydb...    50   6e-05
UniRef50_Q09719 Cluster: ATP-dependent RNA helicase dbp10; n=2; ...    50   6e-05
UniRef50_Q9KNA4 Cluster: ATP-dependent RNA helicase, DEAD box fa...    50   8e-05
UniRef50_Q8EZ11 Cluster: ATP-dependent RNA helicase; n=4; Leptos...    50   8e-05
UniRef50_Q8D7D0 Cluster: Superfamily II DNA and RNA helicase; n=...    50   8e-05
UniRef50_Q5FUQ9 Cluster: ATP-dependent RNA helicase; n=11; cellu...    50   8e-05
UniRef50_A6QHA1 Cluster: ATP-dependent RNA helicase DEAD/DEAH bo...    50   8e-05
UniRef50_A3WD13 Cluster: DNA and RNA helicase; n=2; Alphaproteob...    50   8e-05
UniRef50_Q8SY39 Cluster: LD28101p; n=3; Diptera|Rep: LD28101p - ...    50   8e-05
UniRef50_Q54Y81 Cluster: Putative RNA helicase; n=2; Dictyosteli...    50   8e-05
UniRef50_Q4QC38 Cluster: RNA helicase, putative; n=7; Trypanosom...    50   8e-05
UniRef50_A2DSJ0 Cluster: DEAD/DEAH box helicase family protein; ...    50   8e-05
UniRef50_A0EIJ0 Cluster: Chromosome undetermined scaffold_99, wh...    50   8e-05
UniRef50_A0BPV0 Cluster: Chromosome undetermined scaffold_12, wh...    50   8e-05
UniRef50_P21693 Cluster: ATP-independent RNA helicase dbpA; n=19...    50   8e-05
UniRef50_Q64VR8 Cluster: ATP-dependent RNA helicase DeaD; n=14; ...    49   1e-04
UniRef50_Q5NN72 Cluster: DNA and RNA helicase; n=3; Sphingomonad...    49   1e-04
UniRef50_O83749 Cluster: ATP-dependent RNA helicase; n=2; Trepon...    49   1e-04
UniRef50_A7JLA3 Cluster: ATP-dependent RNA helicase; n=20; Franc...    49   1e-04
UniRef50_A6VTY7 Cluster: DEAD/DEAH box helicase domain protein; ...    49   1e-04
UniRef50_A5FST0 Cluster: DEAD/DEAH box helicase domain protein; ...    49   1e-04
UniRef50_Q96GQ7 Cluster: Probable ATP-dependent RNA helicase DDX...    49   1e-04
UniRef50_A4QTR1 Cluster: ATP-dependent RNA helicase DBP9; n=4; A...    49   1e-04
UniRef50_UPI0000D5571E Cluster: PREDICTED: similar to CG5800-PA;...    49   1e-04
UniRef50_UPI00006CDDA3 Cluster: CLN3 protein; n=1; Tetrahymena t...    49   1e-04
UniRef50_UPI00006CBDDC Cluster: DEAD/DEAH box helicase family pr...    49   1e-04
UniRef50_Q9PGP6 Cluster: ATP-dependent RNA helicase; n=10; cellu...    49   1e-04
UniRef50_Q6MR64 Cluster: ATP-dependent RNA helicase; n=5; cellul...    49   1e-04
UniRef50_Q1N6E2 Cluster: ATP-dependent RNA helicase; n=1; Oceano...    49   1e-04
UniRef50_A4BET4 Cluster: DEAD/DEAH box helicase-like protein; n=...    49   1e-04
UniRef50_Q55BR9 Cluster: Putative uncharacterized protein; n=1; ...    49   1e-04
UniRef50_Q03532 Cluster: ATP-dependent RNA helicase HAS1; n=70; ...    49   1e-04
UniRef50_Q11UI8 Cluster: DEAD box-related helicase; n=3; Sphingo...    48   2e-04
UniRef50_A7HKQ8 Cluster: DEAD/DEAH box helicase domain protein; ...    48   2e-04
UniRef50_A7HG33 Cluster: DEAD/DEAH box helicase domain protein; ...    48   2e-04
UniRef50_A5UZK3 Cluster: DEAD/DEAH box helicase domain protein; ...    48   2e-04
UniRef50_Q9V3C4 Cluster: CG6539-PA; n=1; Drosophila melanogaster...    48   2e-04
UniRef50_A5DPU0 Cluster: ATP-dependent RNA helicase MAK5; n=1; P...    48   2e-04
UniRef50_UPI0000DB7226 Cluster: PREDICTED: similar to Probable A...    48   2e-04
UniRef50_UPI0000DAE40A Cluster: hypothetical protein Rgryl_01000...    48   2e-04
UniRef50_Q6MN67 Cluster: ATP-dependent RNA helicase; n=3; Deltap...    48   2e-04
UniRef50_O34750 Cluster: YfmL protein; n=5; Bacillus|Rep: YfmL p...    48   2e-04
UniRef50_Q0FAJ4 Cluster: Dead-box ATP-dependent RNA helicase; n=...    48   2e-04
UniRef50_A6G4U7 Cluster: DEAD/DEAH box helicase; n=2; Plesiocyst...    48   2e-04
UniRef50_Q7QNT5 Cluster: GLP_88_2286_3572; n=1; Giardia lamblia ...    48   2e-04
UniRef50_Q7Q0A7 Cluster: ENSANGP00000011621; n=5; Endopterygota|...    48   2e-04
UniRef50_A0RUV7 Cluster: Superfamily II helicase; n=3; Thermopro...    48   2e-04
UniRef50_O22907 Cluster: DEAD-box ATP-dependent RNA helicase 24;...    48   2e-04
UniRef50_P32892 Cluster: ATP-dependent RNA helicase DRS1; n=13; ...    48   2e-04
UniRef50_P0C2N8 Cluster: ATP-dependent RNA helicase drs-1; n=16;...    48   2e-04
UniRef50_Q4V836 Cluster: MGC114699 protein; n=9; Deuterostomia|R...    48   3e-04
UniRef50_Q4RK69 Cluster: Chromosome 2 SCAF15032, whole genome sh...    48   3e-04
UniRef50_Q8D3Y6 Cluster: ATP-dependent RNA helicase, DEAD box fa...    48   3e-04
UniRef50_Q3AX69 Cluster: DEAD/DEAH box helicase-like; n=15; Cyan...    48   3e-04
UniRef50_Q1VPX9 Cluster: ATP-independent RNA helicase; n=9; Bact...    48   3e-04
UniRef50_Q08Q14 Cluster: HeliCase, c-terminal:dead/deah box heli...    48   3e-04
UniRef50_O07897 Cluster: Heat resistant RNA dependent ATPase; n=...    48   3e-04
UniRef50_A6TUK6 Cluster: DEAD/DEAH box helicase domain protein; ...    48   3e-04
UniRef50_A4M6V6 Cluster: DEAD/DEAH box helicase domain protein; ...    48   3e-04
UniRef50_A2U1Q9 Cluster: ATP-dependent RNA helicase, DEAD/DEAH b...    48   3e-04
UniRef50_Q4N4B1 Cluster: ATP-dependent RNA helicase, putative; n...    48   3e-04
UniRef50_Q8GUG7 Cluster: DEAD-box ATP-dependent RNA helicase 50;...    48   3e-04
UniRef50_Q9LYJ9 Cluster: DEAD-box ATP-dependent RNA helicase 46;...    48   3e-04
UniRef50_Q8L4E9 Cluster: DEAD-box ATP-dependent RNA helicase 36;...    48   3e-04
UniRef50_Q7S6F3 Cluster: ATP-dependent RNA helicase dbp-9; n=14;...    48   3e-04
UniRef50_UPI0000DB7667 Cluster: PREDICTED: similar to CG32344-PA...    47   4e-04
UniRef50_UPI0000499A01 Cluster: DEAD/DEAH box helicase; n=1; Ent...    47   4e-04
UniRef50_UPI00004987FF Cluster: DEAD/DEAH box helicase; n=5; Ent...    47   4e-04
UniRef50_Q8YXJ0 Cluster: ATP-dependent RNA helicase; n=11; Cyano...    47   4e-04
UniRef50_A5G1U8 Cluster: DEAD/DEAH box helicase domain protein; ...    47   4e-04
UniRef50_A4RYJ1 Cluster: Predicted protein; n=3; Ostreococcus|Re...    47   4e-04
UniRef50_Q7QQX6 Cluster: GLP_383_7421_6129; n=1; Giardia lamblia...    47   4e-04
UniRef50_Q49K88 Cluster: DEAD box RNA helicase; n=1; Toxoplasma ...    47   4e-04
UniRef50_A7SE71 Cluster: Predicted protein; n=1; Nematostella ve...    47   4e-04
UniRef50_Q5BF42 Cluster: Putative uncharacterized protein; n=1; ...    47   4e-04
UniRef50_Q9P9G7 Cluster: DEAD-box RNA helicase; n=3; Methanosarc...    47   4e-04
UniRef50_Q4P3U9 Cluster: ATP-dependent rRNA helicase RRP3; n=20;...    47   4e-04
UniRef50_A5DIX5 Cluster: ATP-dependent RNA helicase ROK1; n=2; P...    47   4e-04
UniRef50_P0C2N7 Cluster: ATP-dependent RNA helicase DRS1; n=2; C...    47   4e-04
UniRef50_Q4S1T3 Cluster: Chromosome undetermined SCAF14764, whol...    47   5e-04
UniRef50_Q9KLE2 Cluster: ATP-dependent RNA helicase DeaD; n=35; ...    47   5e-04
UniRef50_Q4FSS4 Cluster: Possible ATP-dependent DEAD/DEAH box RN...    47   5e-04
UniRef50_Q11WD3 Cluster: Possible ATP-dependent RNA helicase; n=...    47   5e-04
UniRef50_Q11UP8 Cluster: ATP-dependent RNA helicase; n=1; Cytoph...    47   5e-04
UniRef50_Q9LKL6 Cluster: DEAD box protein P68; n=5; Viridiplanta...    47   5e-04
UniRef50_Q2LZJ8 Cluster: GA19670-PA; n=1; Drosophila pseudoobscu...    47   5e-04
UniRef50_Q238V7 Cluster: Type III restriction enzyme, res subuni...    47   5e-04
UniRef50_Q17BP5 Cluster: DEAD box ATP-dependent RNA helicase; n=...    47   5e-04
UniRef50_A0BDD2 Cluster: Chromosome undetermined scaffold_100, w...    47   5e-04
UniRef50_Q5KLJ5 Cluster: Translation initiation factor, putative...    47   5e-04
UniRef50_Q11039 Cluster: Cold-shock DEAD box protein A homolog; ...    47   5e-04
UniRef50_UPI00015BD198 Cluster: UPI00015BD198 related cluster; n...    46   7e-04
UniRef50_UPI0000498CE0 Cluster: DEAD/DEAH box helicase; n=1; Ent...    46   7e-04
UniRef50_Q8D6Y8 Cluster: Superfamily II DNA and RNA helicase; n=...    46   7e-04
UniRef50_Q88XN5 Cluster: ATP-dependent RNA helicase; n=2; Lactob...    46   7e-04
UniRef50_Q6MBR0 Cluster: Putative ATP-dependent RNA helicase; n=...    46   7e-04
UniRef50_Q62J95 Cluster: ATP-dependent RNA helicase RhlE, putati...    46   7e-04
UniRef50_Q2YZZ9 Cluster: Putative uncharacterized protein; n=1; ...    46   7e-04
UniRef50_A5FH33 Cluster: DEAD/DEAH box helicase domain protein; ...    46   7e-04
UniRef50_A1KUM8 Cluster: Putative ATP-dependent RNA helicase; n=...    46   7e-04
UniRef50_A0M3C7 Cluster: RhlE-like DEAD box family ATP-dependent...    46   7e-04
UniRef50_Q3LWE1 Cluster: Translation initiation factor 4A2; n=1;...    46   7e-04
UniRef50_Q5CIF9 Cluster: DEAD-box RNA helicase; n=2; Cryptospori...    46   7e-04
UniRef50_Q4N9Q9 Cluster: DEAD box RNA helicase, putative; n=3; P...    46   7e-04
UniRef50_Q3ZDP1 Cluster: Vasa-like protein; n=7; Neoptera|Rep: V...    46   7e-04
UniRef50_Q17JB5 Cluster: DEAD box ATP-dependent RNA helicase; n=...    46   7e-04
UniRef50_Q4P1Z0 Cluster: Putative uncharacterized protein; n=1; ...    46   7e-04
UniRef50_A4RIF1 Cluster: ATP-dependent RNA helicase DBP5; n=7; A...    46   7e-04
UniRef50_Q9VHP0 Cluster: ATP-dependent RNA helicase bel; n=4; Pr...    46   7e-04
UniRef50_Q502G7 Cluster: LOC553462 protein; n=3; Danio rerio|Rep...    46   0.001
UniRef50_Q8A2K2 Cluster: ATP-dependent RNA helicase; n=10; cellu...    46   0.001
UniRef50_Q82T78 Cluster: RhlE; ATP-dependent RNA helicase RhlE; ...    46   0.001
UniRef50_Q3AZR1 Cluster: DEAD/DEAH box helicase-like; n=2; Synec...    46   0.001
UniRef50_Q4IZ16 Cluster: DEAD/DEAH box helicase:Helicase, C-term...    46   0.001
UniRef50_Q2BIX8 Cluster: Probable ATP-dependent RNA helicase; n=...    46   0.001
UniRef50_Q15T34 Cluster: DEAD/DEAH box helicase-like; n=1; Pseud...    46   0.001
UniRef50_Q01PH0 Cluster: DEAD/DEAH box helicase domain protein; ...    46   0.001
UniRef50_A3EUK2 Cluster: Superfamily II DNA and RNA helicase; n=...    46   0.001
UniRef50_Q014Y7 Cluster: RNA helicase-like protein; n=2; Ostreoc...    46   0.001
UniRef50_Q22308 Cluster: Putative uncharacterized protein; n=7; ...    46   0.001
UniRef50_O97032 Cluster: DjVLGB; n=2; Dugesia|Rep: DjVLGB - Duge...    46   0.001
UniRef50_A7S2R2 Cluster: Predicted protein; n=5; Eumetazoa|Rep: ...    46   0.001
UniRef50_A5K8S1 Cluster: DEAD/DEAH box helicase, putative; n=1; ...    46   0.001
UniRef50_A3QMD4 Cluster: Putative uncharacterized protein mel-46...    46   0.001
UniRef50_Q2GSC7 Cluster: Putative uncharacterized protein; n=6; ...    46   0.001
UniRef50_Q2FKY7 Cluster: DEAD/DEAH box helicase-like; n=1; Metha...    46   0.001
UniRef50_Q7A4G0 Cluster: Probable DEAD-box ATP-dependent RNA hel...    46   0.001
UniRef50_Q5KC99 Cluster: ATP-dependent RNA helicase MAK5; n=2; F...    46   0.001
UniRef50_Q09903 Cluster: ATP-dependent RNA helicase drs1; n=1; S...    46   0.001
UniRef50_Q81QF0 Cluster: ATP-dependent RNA helicase, DEAD/DEAH b...    46   0.001
UniRef50_Q6MQY6 Cluster: ATP-dependent RNA helicase; n=1; Bdello...    46   0.001
UniRef50_Q6MHS8 Cluster: ATP-dependent RNA helicase; n=1; Bdello...    46   0.001
UniRef50_Q5ZT20 Cluster: ATP-dependent RNA helicase; n=4; Legion...    46   0.001
UniRef50_Q5FS73 Cluster: ATP-dependent RNA helicase; n=2; Glucon...    46   0.001
UniRef50_A6W6A7 Cluster: DEAD/DEAH box helicase domain protein; ...    46   0.001
UniRef50_A6VX62 Cluster: DEAD/DEAH box helicase domain protein; ...    46   0.001
UniRef50_A6H0L1 Cluster: Probable ATP-dependent RNA helicase, DE...    46   0.001
UniRef50_A6DK15 Cluster: ATP-dependent RNA helicase, specific fo...    46   0.001
UniRef50_A4C6L9 Cluster: ATP-dependent RNA helicase, DEAD box fa...    46   0.001
UniRef50_A7APE7 Cluster: DEAD/DEAH box helicase domain containin...    46   0.001
UniRef50_Q2NEZ7 Cluster: Predicted helicase; n=6; cellular organ...    46   0.001
UniRef50_Q9NY93 Cluster: Probable ATP-dependent RNA helicase DDX...    46   0.001
UniRef50_Q4IF76 Cluster: ATP-dependent RNA helicase DBP2; n=4; F...    46   0.001
UniRef50_Q89IS2 Cluster: Cold-shock dead-box protein A; n=28; Al...    45   0.002
UniRef50_Q81RE0 Cluster: ATP-dependent RNA helicase, DEAD/DEAH b...    45   0.002
UniRef50_Q0G0P8 Cluster: Superfamily II DNA and RNA helicase; n=...    45   0.002
UniRef50_Q0BSI7 Cluster: ATP-dependent RNA helicase; n=12; Alpha...    45   0.002
UniRef50_A6NSW7 Cluster: Putative uncharacterized protein; n=1; ...    45   0.002
UniRef50_A5CVQ6 Cluster: ATP-dependent RNA helicase DeaD; n=2; s...    45   0.002
UniRef50_A4LYS0 Cluster: DEAD/DEAH box helicase domain protein; ...    45   0.002
UniRef50_Q2PZC2 Cluster: Vasa protein; n=3; Apidae|Rep: Vasa pro...    45   0.002
UniRef50_Q1AG34 Cluster: Ded1-like DEAD-box RNA helicase; n=1; C...    45   0.002
UniRef50_Q9ZRZ8 Cluster: DEAD-box ATP-dependent RNA helicase 28;...    45   0.002
UniRef50_Q9SB89 Cluster: DEAD-box ATP-dependent RNA helicase 27;...    45   0.002
UniRef50_A5E572 Cluster: ATP-dependent RNA helicase DBP9; n=2; S...    45   0.002
UniRef50_UPI0001555979 Cluster: PREDICTED: similar to ATP-depend...    45   0.002
UniRef50_UPI00004992E6 Cluster: DEAD/DEAH box helicase; n=3; Ent...    45   0.002
UniRef50_Q5QY63 Cluster: ATP-dependent RNA helicase; n=3; Altero...    45   0.002
UniRef50_Q5NZY2 Cluster: ATP-dependent RNA helicase DeaD; n=18; ...    45   0.002
UniRef50_O66866 Cluster: ATP-dependent RNA helicase DeaD; n=1; A...    45   0.002
UniRef50_Q14NT1 Cluster: Putative atp-dependent rna helicase pro...    45   0.002
UniRef50_Q12QV2 Cluster: DEAD/DEAH box helicase-like protein; n=...    45   0.002
UniRef50_A6QC93 Cluster: ATP-independent RNA helicase DbpA; n=1;...    45   0.002
UniRef50_A0RP33 Cluster: Putative ATP-dependent RNA helicase Rhl...    45   0.002
UniRef50_Q95XM9 Cluster: Putative uncharacterized protein; n=2; ...    45   0.002
UniRef50_Q688Z4 Cluster: Putative uncharacterized protein; n=3; ...    45   0.002
UniRef50_Q4MZS9 Cluster: ATP-dependent RNA helicase, putative; n...    45   0.002
UniRef50_Q4JG17 Cluster: Vasa-like protein; n=1; Litopenaeus van...    45   0.002
UniRef50_Q22MC1 Cluster: Type III restriction enzyme, res subuni...    45   0.002
UniRef50_Q16W98 Cluster: DEAD box ATP-dependent RNA helicase; n=...    45   0.002
UniRef50_Q0DVX2 Cluster: DEAD-box ATP-dependent RNA helicase 50;...    45   0.002
UniRef50_P93008 Cluster: DEAD-box ATP-dependent RNA helicase 21;...    45   0.002
UniRef50_Q9NXZ2 Cluster: Probable ATP-dependent RNA helicase DDX...    45   0.002
UniRef50_A5DC85 Cluster: ATP-dependent RNA helicase DBP9; n=4; S...    45   0.002
UniRef50_Q8SR01 Cluster: ATP-dependent RNA helicase DBP4; n=1; E...    45   0.002
UniRef50_UPI0000499ECF Cluster: DEAD/DEAH box helicase; n=1; Ent...    44   0.003
UniRef50_A1U3D6 Cluster: DEAD/DEAH box helicase domain protein; ...    44   0.003
UniRef50_A0VLH7 Cluster: DEAD/DEAH box helicase domain protein; ...    44   0.003
UniRef50_A0KTC9 Cluster: DEAD/DEAH box helicase domain protein; ...    44   0.003
UniRef50_Q8MZI3 Cluster: GH10652p; n=2; Drosophila melanogaster|...    44   0.003
UniRef50_Q869P0 Cluster: Similar to Homo sapiens (Human). DEAD/D...    44   0.003
UniRef50_Q7QP86 Cluster: GLP_397_1016_18; n=1; Giardia lamblia A...    44   0.003
UniRef50_Q5CX71 Cluster: Hca4p helicase DBP4 (Helicase CA4). EIF...    44   0.003
UniRef50_A7U5W7 Cluster: DEAD-box helicase 2; n=6; Plasmodium|Re...    44   0.003
UniRef50_A2DFG9 Cluster: DEAD/DEAH box helicase family protein; ...    44   0.003
UniRef50_Q8NJW1 Cluster: CYT-19 DEAD-box protein precursor; n=1;...    44   0.003
UniRef50_A3BT52 Cluster: DEAD-box ATP-dependent RNA helicase 29;...    44   0.003
UniRef50_Q4IBS2 Cluster: ATP-dependent RNA helicase MAK5; n=2; S...    44   0.003
UniRef50_Q8SQK9 Cluster: ATP-dependent RNA helicase DHH1; n=1; E...    44   0.003
UniRef50_Q7RYZ7 Cluster: ATP-dependent RNA helicase dbp-8; n=15;...    44   0.003
UniRef50_UPI00015B6038 Cluster: PREDICTED: similar to DEAD box A...    44   0.004
UniRef50_UPI0000499D6F Cluster: DEAD/DEAH box helicase; n=1; Ent...    44   0.004
UniRef50_Q5FNK0 Cluster: ATP-dependent RNA helicase; n=1; Glucon...    44   0.004
UniRef50_Q30SZ2 Cluster: DEAD/DEAH box helicase-like; n=1; Thiom...    44   0.004
UniRef50_Q30P62 Cluster: DEAD/DEAH box helicase-like; n=1; Thiom...    44   0.004
UniRef50_Q18W60 Cluster: DEAD/DEAH box helicase-like; n=2; Desul...    44   0.004
UniRef50_Q0BUS0 Cluster: ATP-dependent RNA helicase; n=3; Rhodos...    44   0.004
UniRef50_A6TTG0 Cluster: DEAD/DEAH box helicase domain protein; ...    44   0.004
UniRef50_A6DIU5 Cluster: Probable ATP dependent RNA helicase; n=...    44   0.004
UniRef50_A4S6M9 Cluster: Predicted protein; n=3; Ostreococcus|Re...    44   0.004
UniRef50_Q54CD8 Cluster: Putative RNA helicase; n=2; Dictyosteli...    44   0.004
UniRef50_A4UCU0 Cluster: DEAD box polypeptide 47 isoform 1 varia...    44   0.004
UniRef50_Q0CMM5 Cluster: Putative uncharacterized protein; n=2; ...    44   0.004
UniRef50_A3H9E9 Cluster: DEAD/DEAH box helicase-like; n=1; Caldi...    44   0.004
UniRef50_P44701 Cluster: ATP-dependent RNA helicase srmB homolog...    44   0.004
UniRef50_Q9SQV1 Cluster: Probable DEAD-box ATP-dependent RNA hel...    44   0.004
UniRef50_A5E058 Cluster: Pre-mRNA-processing ATP-dependent RNA h...    44   0.004
UniRef50_Q9P7C7 Cluster: Pre-mRNA-processing ATP-dependent RNA h...    44   0.004
UniRef50_Q5KIK3 Cluster: ATP-dependent RNA helicase DRS1; n=1; F...    44   0.004
UniRef50_Q8TDD1 Cluster: ATP-dependent RNA helicase DDX54; n=45;...    44   0.004
UniRef50_Q9H0S4 Cluster: Probable ATP-dependent RNA helicase DDX...    44   0.004
UniRef50_UPI00015B61D8 Cluster: PREDICTED: similar to vasa-like ...    44   0.005
UniRef50_UPI0000F3242A Cluster: Probable ATP-dependent RNA helic...    44   0.005
UniRef50_Q9KKW0 Cluster: ATP-dependent RNA helicase, DEAD box fa...    44   0.005
UniRef50_Q89M45 Cluster: ATP-dependent RNA helicase; n=29; cellu...    44   0.005
UniRef50_Q87HW1 Cluster: ATP-dependent RNA helicase, DEAD box fa...    44   0.005
UniRef50_Q31AC4 Cluster: DEAD/DEAH box helicase-like protein; n=...    44   0.005
UniRef50_Q30YG9 Cluster: DEAD/DEAH box helicase-like; n=3; Delta...    44   0.005
UniRef50_Q2LY23 Cluster: Superfamily II DNA and RNA helicases; n...    44   0.005
UniRef50_Q2BP56 Cluster: Putative ATP-dependent RNA helicase; n=...    44   0.005
UniRef50_Q0HYG8 Cluster: DEAD/DEAH box helicase domain protein; ...    44   0.005
UniRef50_A4B5L7 Cluster: ATP-dependent RNA helicase DbpA; n=3; P...    44   0.005
UniRef50_A0UX17 Cluster: DEAD/DEAH box helicase-like; n=5; Clost...    44   0.005
UniRef50_Q9VRI0 Cluster: CG1666-PA; n=22; Eumetazoa|Rep: CG1666-...    44   0.005
UniRef50_Q4Q1N9 Cluster: DEAD box RNA helicase, putative; n=5; T...    44   0.005
UniRef50_Q17CR5 Cluster: DEAD box ATP-dependent RNA helicase; n=...    44   0.005
UniRef50_Q16T16 Cluster: DEAD box ATP-dependent RNA helicase; n=...    44   0.005
UniRef50_A0E4U1 Cluster: Chromosome undetermined scaffold_79, wh...    44   0.005
UniRef50_Q59H21 Cluster: ATP-dependent RNA helicase ROK1 isoform...    44   0.005
UniRef50_Q55RL6 Cluster: Putative uncharacterized protein; n=2; ...    44   0.005
UniRef50_Q9HXE5 Cluster: ATP-dependent RNA helicase rhlB; n=22; ...    44   0.005
UniRef50_Q9Y2R4 Cluster: Probable ATP-dependent RNA helicase DDX...    44   0.005
UniRef50_Q9BUQ8 Cluster: Probable ATP-dependent RNA helicase DDX...    44   0.005
UniRef50_UPI0000498D8E Cluster: ATP-dependent RNA helicase; n=1;...    43   0.007
UniRef50_Q4SJI2 Cluster: Chromosome 4 SCAF14575, whole genome sh...    43   0.007
UniRef50_Q9K7L3 Cluster: RNA helicase; n=2; Bacillus|Rep: RNA he...    43   0.007
UniRef50_Q39MK8 Cluster: DEAD/DEAH box helicase; n=10; Proteobac...    43   0.007
UniRef50_Q41F45 Cluster: Helicase, C-terminal:DEAD/DEAH box heli...    43   0.007
UniRef50_Q0HKH0 Cluster: DEAD/DEAH box helicase domain protein; ...    43   0.007
UniRef50_A6GPV2 Cluster: Helicase; n=1; Limnobacter sp. MED105|R...    43   0.007
UniRef50_Q8I0W7 Cluster: Snrnp protein, putative; n=6; Plasmodiu...    43   0.007
UniRef50_A5K9H3 Cluster: Pre-mRNA splicing factor RNA helicase P...    43   0.007
UniRef50_Q9LUW5 Cluster: DEAD-box ATP-dependent RNA helicase 53;...    43   0.007
UniRef50_Q06218 Cluster: ATP-dependent RNA helicase DBP9; n=4; A...    43   0.007
UniRef50_Q0UMB6 Cluster: ATP-dependent RNA helicase DBP10; n=1; ...    43   0.007
UniRef50_UPI000023DE12 Cluster: hypothetical protein FG05108.1; ...    43   0.009
UniRef50_Q92GV2 Cluster: ATP-dependent RNA helicase RhlE; n=10; ...    43   0.009
UniRef50_Q5NML9 Cluster: DNA and RNA helicase; n=28; Alphaproteo...    43   0.009
UniRef50_Q11U28 Cluster: ATP-dependent RNA helicase protein; n=4...    43   0.009
UniRef50_Q0LVA0 Cluster: Helicase-like:DEAD/DEAH box helicase-li...    43   0.009
UniRef50_Q0C4R1 Cluster: ATP-dependent RNA helicase, DEAD/DEAH b...    43   0.009
UniRef50_A6VWX2 Cluster: DEAD/DEAH box helicase domain protein; ...    43   0.009
UniRef50_A3I404 Cluster: Putative uncharacterized protein; n=1; ...    43   0.009
UniRef50_A3I1F5 Cluster: DEAD/DEAH box helicase-like protein; n=...    43   0.009
UniRef50_A1FEC3 Cluster: DEAD/DEAH box helicase-like; n=21; Gamm...    43   0.009
UniRef50_Q4QJG6 Cluster: ATP-dependent RNA helicase, putative; n...    43   0.009
UniRef50_Q2GSJ4 Cluster: Putative uncharacterized protein; n=2; ...    43   0.009
UniRef50_A6QYH1 Cluster: 2-isopropylmalate synthase; n=4; Ascomy...    43   0.009
UniRef50_Q0U6X2 Cluster: ATP-dependent RNA helicase MAK5; n=2; P...    43   0.009
UniRef50_Q9NVP1 Cluster: ATP-dependent RNA helicase DDX18; n=24;...    43   0.009
UniRef50_Q5KPU1 Cluster: ATP-dependent RNA helicase DBP8; n=2; F...    43   0.009
UniRef50_P20448 Cluster: ATP-dependent RNA helicase DBP4; n=13; ...    43   0.009
UniRef50_Q4P3W3 Cluster: ATP-dependent RNA helicase DBP10; n=1; ...    43   0.009
UniRef50_Q2H0R2 Cluster: ATP-dependent RNA helicase DBP10; n=1; ...    43   0.009
UniRef50_UPI00015609AE Cluster: PREDICTED: similar to DEAD (Asp-...    42   0.012
UniRef50_Q8AYI1 Cluster: Vasa-like protein; n=1; Squalus acanthi...    42   0.012
UniRef50_Q89UH0 Cluster: Dead-box ATP-dependent RNA helicase; n=...    42   0.012
UniRef50_Q836U7 Cluster: ATP-dependent RNA helicase, DEAD/DEAH b...    42   0.012
UniRef50_Q480Z7 Cluster: ATP-dependent RNA helicase, DEAD box fa...    42   0.012
UniRef50_Q31EF0 Cluster: ATP-dependent RNA helicase; n=1; Thiomi...    42   0.012
UniRef50_A3ZWP8 Cluster: ATP-dependent RNA helicase; n=1; Blasto...    42   0.012
UniRef50_A0KXT6 Cluster: DEAD/DEAH box helicase domain protein; ...    42   0.012
UniRef50_Q00T47 Cluster: Putative RNA helicase, DRH1; n=1; Ostre...    42   0.012
UniRef50_Q7K4L8 Cluster: LD33749p; n=1; Drosophila melanogaster|...    42   0.012
UniRef50_Q675R0 Cluster: ATP-dependent 61 kDa nucleolar RNA heli...    42   0.012
UniRef50_Q4W7T8 Cluster: VASA RNA helicase; n=1; Artemia francis...    42   0.012
UniRef50_Q4W7T7 Cluster: VASA RNA helicase; n=3; Daphniidae|Rep:...    42   0.012
UniRef50_O17157 Cluster: Putative uncharacterized protein; n=3; ...    42   0.012
UniRef50_Q88NB7 Cluster: ATP-dependent RNA helicase rhlB; n=18; ...    42   0.012
UniRef50_Q8W4E1 Cluster: DEAD-box ATP-dependent RNA helicase 47;...    42   0.012
UniRef50_Q10RI7 Cluster: DEAD-box ATP-dependent RNA helicase 38;...    42   0.012
UniRef50_Q93ZG7 Cluster: DEAD-box ATP-dependent RNA helicase 38;...    42   0.012
UniRef50_O49289 Cluster: Putative DEAD-box ATP-dependent RNA hel...    42   0.012
UniRef50_Q9FNM7 Cluster: DEAD-box ATP-dependent RNA helicase 26;...    42   0.012
UniRef50_Q750Q4 Cluster: ATP-dependent RNA helicase MSS116, mito...    42   0.012
UniRef50_Q5KN79 Cluster: ATP-dependent RNA helicase DBP4; n=1; F...    42   0.012
UniRef50_Q6C7X8 Cluster: ATP-dependent RNA helicase DBP10; n=3; ...    42   0.012
UniRef50_UPI0000E87E35 Cluster: putative ATP-dependent RNA helic...    42   0.016
UniRef50_UPI000051A2EE Cluster: PREDICTED: similar to Helicase C...    42   0.016
UniRef50_UPI000049A17D Cluster: helicase; n=1; Entamoeba histoly...    42   0.016
UniRef50_Q1VL45 Cluster: DEAD/DEAH box helicase-like protein; n=...    42   0.016
UniRef50_Q11TW3 Cluster: Possible ATP-dependent RNA helicase; n=...    42   0.016
UniRef50_A1USG3 Cluster: DEAD/DEAH box helicase domain/helicase ...    42   0.016
UniRef50_A0KZD5 Cluster: DEAD/DEAH box helicase domain protein; ...    42   0.016
UniRef50_Q5CHB7 Cluster: Putative uncharacterized protein; n=2; ...    42   0.016
UniRef50_Q22T03 Cluster: DEAD/DEAH box helicase family protein; ...    42   0.016
UniRef50_Q16KK0 Cluster: DEAD box ATP-dependent RNA helicase; n=...    42   0.016
UniRef50_A7ETZ1 Cluster: Putative uncharacterized protein; n=1; ...    42   0.016
UniRef50_A6SDG8 Cluster: Putative uncharacterized protein; n=1; ...    42   0.016
UniRef50_A6RW79 Cluster: Putative uncharacterized protein; n=1; ...    42   0.016
UniRef50_Q0E3X4 Cluster: DEAD-box ATP-dependent RNA helicase 35A...    42   0.016
UniRef50_Q1E7Y4 Cluster: ATP-dependent RNA helicase MAK5; n=11; ...    42   0.016
UniRef50_Q4P7M1 Cluster: ATP-dependent RNA helicase DBP9; n=2; U...    42   0.016
UniRef50_Q8SRB2 Cluster: ATP-dependent RNA helicase DBP2; n=103;...    42   0.016
UniRef50_Q81JK1 Cluster: ATP-dependent RNA helicase, DEAD/DEAH b...    42   0.021
UniRef50_Q7VQL9 Cluster: Cold-shock DEAD-box protein A, inducibl...    42   0.021
UniRef50_Q6D2K3 Cluster: ATP-independent RNA helicase; n=6; Prot...    42   0.021
UniRef50_Q41FS1 Cluster: IMP dehydrogenase/GMP reductase:Helicas...    42   0.021
UniRef50_A4B385 Cluster: ATP-dependent RNA helicase, DEAD box fa...    42   0.021
UniRef50_A3JG19 Cluster: ATP-dependent RNA helicase; n=1; Marino...    42   0.021
UniRef50_A1G315 Cluster: DEAD/DEAH box helicase-like; n=2; Salin...    42   0.021
UniRef50_A4S6F2 Cluster: Predicted protein; n=1; Ostreococcus lu...    42   0.021
UniRef50_Q965K2 Cluster: Putative uncharacterized protein; n=2; ...    42   0.021
UniRef50_Q58HG3 Cluster: DEAD-box RNA helicase; n=4; Eukaryota|R...    42   0.021
UniRef50_Q54TD7 Cluster: Putative uncharacterized protein; n=1; ...    42   0.021
UniRef50_Q4Y0X7 Cluster: DEAD-box RNA helicase, putative; n=2; P...    42   0.021
UniRef50_Q4MYL1 Cluster: ATP-dependent RNA helicase, putative; n...    42   0.021
UniRef50_Q388E8 Cluster: ATP-dependent DEAD/H RNA helicase, puta...    42   0.021
UniRef50_A6N5Z1 Cluster: Helicase; n=7; Plasmodium|Rep: Helicase...    42   0.021
UniRef50_A2DHK0 Cluster: DEAD/DEAH box helicase family protein; ...    42   0.021
UniRef50_A0C369 Cluster: Chromosome undetermined scaffold_146, w...    42   0.021
UniRef50_Q5UQD1 Cluster: Putative ATP-dependent RNA helicase R45...    42   0.021
UniRef50_Q9PA24 Cluster: ATP-dependent RNA helicase rhlB; n=87; ...    42   0.021
UniRef50_Q6CZD9 Cluster: ATP-dependent RNA helicase rhlB; n=2; G...    42   0.021
UniRef50_Q5KME7 Cluster: Pre-mRNA-processing ATP-dependent RNA h...    42   0.021
UniRef50_A5DU73 Cluster: Pre-mRNA-splicing ATP-dependent RNA hel...    42   0.021
UniRef50_A5DUB2 Cluster: ATP-dependent RNA helicase MAK5; n=5; S...    42   0.021
UniRef50_Q58083 Cluster: Probable ATP-dependent RNA helicase MJ0...    42   0.021
UniRef50_Q4P9P3 Cluster: ATP-dependent RNA helicase DRS1; n=1; U...    42   0.021
UniRef50_Q81LV0 Cluster: ATP-dependent RNA helicase, DEAD/DEAH b...    41   0.027
UniRef50_Q7NAY1 Cluster: SrmB; n=1; Mycoplasma gallisepticum|Rep...    41   0.027
UniRef50_Q6YPL1 Cluster: Superfamily II DNA and RNA helicase; n=...    41   0.027
UniRef50_Q5QWG1 Cluster: ATP-dependent RNA helicase; n=1; Idioma...    41   0.027
UniRef50_Q1GJ43 Cluster: DEAD/DEAH box helicase-like protein; n=...    41   0.027
UniRef50_Q12B10 Cluster: DEAD/DEAH box helicase-like; n=13; Prot...    41   0.027
UniRef50_Q087U7 Cluster: DEAD/DEAH box helicase domain protein; ...    41   0.027
UniRef50_A7CUH7 Cluster: DEAD/DEAH box helicase domain protein; ...    41   0.027
UniRef50_A0V009 Cluster: DEAD/DEAH box helicase-like; n=1; Clost...    41   0.027
UniRef50_A4S507 Cluster: Predicted protein; n=2; Ostreococcus|Re...    41   0.027
UniRef50_A2WLP5 Cluster: Putative uncharacterized protein; n=3; ...    41   0.027
UniRef50_Q7QQ49 Cluster: GLP_139_12217_14094; n=1; Giardia lambl...    41   0.027
UniRef50_Q7JQN4 Cluster: LD15481p; n=7; Endopterygota|Rep: LD154...    41   0.027
UniRef50_Q5D9C4 Cluster: SJCHGC09528 protein; n=1; Schistosoma j...    41   0.027
UniRef50_Q4UE18 Cluster: RNA helicase, putative; n=2; Theileria|...    41   0.027
UniRef50_A7ANF1 Cluster: DEAD/DEAH box domain containing protein...    41   0.027
UniRef50_A5K9E1 Cluster: DEAD-box subfamily ATP-dependant helica...    41   0.027
UniRef50_A2EAD4 Cluster: DEAD/DEAH box helicase family protein; ...    41   0.027
UniRef50_A0T1H5 Cluster: SF2-family helicase; n=6; Plasmodium|Re...    41   0.027
UniRef50_P54475 Cluster: Probable ATP-dependent RNA helicase yqf...    41   0.027
UniRef50_Q8SR63 Cluster: ATP-dependent rRNA helicase RRP3; n=1; ...    41   0.027
UniRef50_Q8EJQ5 Cluster: ATP-dependent RNA helicase rhlB; n=62; ...    41   0.027
UniRef50_Q4IP34 Cluster: Pre-mRNA-processing ATP-dependent RNA h...    41   0.027
UniRef50_UPI00015B4D1B Cluster: PREDICTED: similar to DEAD box A...    41   0.036
UniRef50_UPI000155CE2F Cluster: PREDICTED: similar to R27090_2; ...    41   0.036
UniRef50_Q9PPQ7 Cluster: ATP-dependent RNA helicase; n=1; Ureapl...    41   0.036
UniRef50_Q8YH70 Cluster: ATP-DEPENDENT RNA HELICASE RHLE; n=10; ...    41   0.036
UniRef50_Q8F0Q7 Cluster: ATP-dependent RNA helicase; n=4; Leptos...    41   0.036
UniRef50_Q2BMZ1 Cluster: ATP-dependent RNA helicase; n=1; Neptun...    41   0.036
UniRef50_Q1MYS3 Cluster: Probable ATP-dependent RNA helicase; n=...    41   0.036
UniRef50_A6DHU9 Cluster: DEAD/DEAH box helicase-like protein; n=...    41   0.036
UniRef50_A2SJY2 Cluster: Putative ATP-dependent RNA helicase; n=...    41   0.036
UniRef50_A1VA48 Cluster: DEAD/DEAH box helicase domain protein; ...    41   0.036
UniRef50_Q014T4 Cluster: Chromosome 07 contig 1, DNA sequence; n...    41   0.036
UniRef50_Q00X54 Cluster: RNA Helicase; n=2; Ostreococcus|Rep: RN...    41   0.036
UniRef50_Q9VXW2 Cluster: CG6227-PA; n=11; Coelomata|Rep: CG6227-...    41   0.036
UniRef50_Q86IZ9 Cluster: Similar to Rattus norvegicus (Rat). ROK...    41   0.036
UniRef50_Q389T9 Cluster: ATP-dependent DEAD/H RNA helicase, puta...    41   0.036
UniRef50_A5KAD4 Cluster: Helicase, putative; n=1; Plasmodium viv...    41   0.036
UniRef50_A4IBK1 Cluster: ATP-dependent RNA helicase, putative; n...    41   0.036
UniRef50_A0CZH3 Cluster: Chromosome undetermined scaffold_32, wh...    41   0.036
UniRef50_A7TSU7 Cluster: Putative uncharacterized protein; n=1; ...    41   0.036
UniRef50_Q4WRP2 Cluster: ATP-dependent RNA helicase mss116, mito...    41   0.036
UniRef50_Q966L9 Cluster: ATP-dependent RNA helicase glh-2; n=4; ...    41   0.036
UniRef50_Q9Y6V7 Cluster: Probable ATP-dependent RNA helicase DDX...    41   0.036
UniRef50_Q4PEX7 Cluster: ATP-dependent RNA helicase DBP8; n=1; U...    41   0.036
UniRef50_Q2H2J1 Cluster: ATP-dependent RNA helicase DBP4; n=14; ...    41   0.036
UniRef50_P20447 Cluster: ATP-dependent RNA helicase DBP3; n=20; ...    41   0.036
UniRef50_Q9V3C0 Cluster: ATP-dependent RNA helicase abstrakt; n=...    41   0.036
UniRef50_Q8A8L3 Cluster: ATP-independent RNA helicase; n=7; Bact...    40   0.047
UniRef50_A6PQ62 Cluster: DEAD/DEAH box helicase domain protein; ...    40   0.047
UniRef50_A3ZXX1 Cluster: ATP-dependent RNA helicase; n=2; Planct...    40   0.047
UniRef50_Q9SWV9 Cluster: Ethylene-responsive RNA helicase; n=5; ...    40   0.047
UniRef50_Q3LW03 Cluster: UB2 probably involved in pre-mRNA splic...    40   0.047
UniRef50_Q9GV13 Cluster: Vasa-related protein CnVAS1; n=3; Eumet...    40   0.047

>UniRef50_Q4T4A9 Cluster: Chromosome undetermined SCAF9757, whole
           genome shotgun sequence; n=2; Euteleostomi|Rep:
           Chromosome undetermined SCAF9757, whole genome shotgun
           sequence - Tetraodon nigroviridis (Green puffer)
          Length = 215

 Score =  113 bits (271), Expect = 6e-24
 Identities = 50/62 (80%), Positives = 56/62 (90%)
 Frame = +3

Query: 72  GHLHTDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGT 251
           G + T+WD VV+ FDDMNLKE LLRG+YAYGFEKPSAIQQRAI+PCI+G DVIAQAQSGT
Sbjct: 19  GVIETNWDTVVDNFDDMNLKESLLRGVYAYGFEKPSAIQQRAILPCIKGHDVIAQAQSGT 78

Query: 252 GK 257
           GK
Sbjct: 79  GK 80



 Score = 59.7 bits (138), Expect = 7e-08
 Identities = 30/38 (78%), Positives = 34/38 (89%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKV 367
           KTATF ISILQ+IDTS++E QALILAPTRELAQQ  K+
Sbjct: 80  KTATFVISILQRIDTSLKETQALILAPTRELAQQEWKL 117


>UniRef50_Q14240 Cluster: Eukaryotic initiation factor 4A-II; n=37;
           Bilateria|Rep: Eukaryotic initiation factor 4A-II - Homo
           sapiens (Human)
          Length = 407

 Score =  109 bits (262), Expect = 7e-23
 Identities = 48/62 (77%), Positives = 57/62 (91%)
 Frame = +3

Query: 72  GHLHTDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGT 251
           G + ++W+++V+ FDDMNLKE LLRGIYAYGFEKPSAIQQRAI+PCI+G DVIAQAQSGT
Sbjct: 22  GVIESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGT 81

Query: 252 GK 257
           GK
Sbjct: 82  GK 83



 Score =  107 bits (256), Expect = 4e-22
 Identities = 64/151 (42%), Positives = 92/151 (60%), Gaps = 5/151 (3%)
 Frame = +2

Query: 17  NGPSKDQG-SYDGPPGMDPGTLAHRLGSSCRNLR*HEPQRRIVERHIRLWF*KTFCNP-A 190
           +G S D    + GP GMDP  +   + S+   +  +     + E  +R  +   F  P A
Sbjct: 2   SGGSADYNREHGGPEGMDPDGV---IESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPSA 58

Query: 191 TRNNALHPRTRCY---RSSPVRNWKTATFSISILQQIDTSIRECQALILAPTRELAQQIQ 361
            +  A+ P  + Y     +     KTATF+ISILQQ++   +E QAL+LAPTRELAQQIQ
Sbjct: 59  IQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQ 118

Query: 362 KVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           KV++ALGD++ A CHACIGGTNVR ++++L+
Sbjct: 119 KVILALGDYMGATCHACIGGTNVRNEMQKLQ 149


>UniRef50_Q4SP80 Cluster: Chromosome 15 SCAF14542, whole genome
           shotgun sequence; n=5; Euteleostomi|Rep: Chromosome 15
           SCAF14542, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 366

 Score =  107 bits (256), Expect = 4e-22
 Identities = 47/62 (75%), Positives = 55/62 (88%)
 Frame = +3

Query: 72  GHLHTDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGT 251
           G + ++W ++ + FDDMNLKE LLRGIYAYGFEKPSAIQQRAI+PCI+G DVIAQAQSGT
Sbjct: 24  GIIESNWTEITDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGT 83

Query: 252 GK 257
           GK
Sbjct: 84  GK 85



 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 43/114 (37%), Positives = 61/114 (53%), Gaps = 4/114 (3%)
 Frame = +2

Query: 26  SKDQGSYDGPPGMDPGTLAHRLGSSCRNLR*HEPQRRIVERHIRLWF*KTFCNP-ATRNN 202
           SKD G   GP GM+P  +   + S+   +  +     + E  +R  +   F  P A +  
Sbjct: 11  SKDHG---GPDGMEPDGI---IESNWTEITDNFDDMNLKESLLRGIYAYGFEKPSAIQQR 64

Query: 203 ALHPRTRCY---RSSPVRNWKTATFSISILQQIDTSIRECQALILAPTRELAQQ 355
           A+ P  + Y     +     KTATF+ISILQQ++   +E QAL+LAPTRELAQQ
Sbjct: 65  AIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIDQKETQALVLAPTRELAQQ 118


>UniRef50_P38919 Cluster: Eukaryotic initiation factor 4A-III;
           n=366; root|Rep: Eukaryotic initiation factor 4A-III -
           Homo sapiens (Human)
          Length = 411

 Score =  106 bits (254), Expect = 6e-22
 Identities = 49/67 (73%), Positives = 59/67 (88%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTATFSIS+LQ +D  +RE QALILAPTRELA QIQK ++ALGD++N +CHACIGGTNV 
Sbjct: 88  KTATFSISVLQCLDIQVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNVG 147

Query: 434 EDIRQLE 454
           EDIR+L+
Sbjct: 148 EDIRKLD 154



 Score = 88.6 bits (210), Expect = 1e-16
 Identities = 42/53 (79%), Positives = 46/53 (86%)
 Frame = +3

Query: 99  VVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           V  TFD M L+E+LLRGIYAYGFEKPSAIQQRAI   I+GRDVIAQ+QSGTGK
Sbjct: 36  VTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGK 88


>UniRef50_A5BYF4 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 377

 Score = 91.5 bits (217), Expect = 2e-17
 Identities = 44/82 (53%), Positives = 61/82 (74%), Gaps = 6/82 (7%)
 Frame = +3

Query: 84  TDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK-- 257
           T+  +++ +FD M +K +LLRGIYAY FEKPSA+QQRA++P IQG DVIAQAQSGTGK  
Sbjct: 269 TEGVELIMSFDQMGIKNDLLRGIYAYSFEKPSAVQQRAVLPIIQGHDVIAQAQSGTGKTS 328

Query: 258 -LLLSLYRFY---NKSIQAFVN 311
              L++Y+     N+ +QA ++
Sbjct: 329 MFALTVYQMVDTSNREVQALIS 350



 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 27/51 (52%), Positives = 40/51 (78%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCH 406
           KT+ F++++ Q +DTS RE QALI +PTRELA Q +KV++A+GD +N + H
Sbjct: 326 KTSMFALTVYQMVDTSNREVQALISSPTRELASQTEKVILAIGDSVNIQAH 376


>UniRef50_A0D232 Cluster: Chromosome undetermined scaffold_35, whole
           genome shotgun sequence; n=5; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_35,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 434

 Score = 89.4 bits (212), Expect = 8e-17
 Identities = 39/60 (65%), Positives = 51/60 (85%)
 Frame = +3

Query: 78  LHTDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           L  +W + VETF+D+ L ++LLRGI++YGFE+PSAIQQ+AI P I G+DV+AQAQSGTGK
Sbjct: 47  LQENWIEQVETFEDLTLSKDLLRGIFSYGFERPSAIQQKAIKPIILGKDVLAQAQSGTGK 106



 Score = 68.5 bits (160), Expect = 2e-10
 Identities = 32/61 (52%), Positives = 43/61 (70%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KT TF+I  LQ+ID + R+ Q +ILAP RELA+QI  VV  +G +LN +   CIGGT+ +
Sbjct: 106 KTGTFTIGALQRIDPNQRKTQVIILAPVRELAKQIYDVVKGIGQYLNIEAFCCIGGTSTQ 165

Query: 434 E 436
           E
Sbjct: 166 E 166


>UniRef50_A2AAP7 Cluster: DEAD (Asp-Glu-Ala-Asp) box polypeptide 48;
           n=5; Fungi/Metazoa group|Rep: DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 48 - Mus musculus (Mouse)
          Length = 299

 Score = 88.6 bits (210), Expect = 1e-16
 Identities = 42/53 (79%), Positives = 46/53 (86%)
 Frame = +3

Query: 99  VVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           V  TFD M L+E+LLRGIYAYGFEKPSAIQQRAI   I+GRDVIAQ+QSGTGK
Sbjct: 36  VTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGK 88



 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 32/67 (47%), Positives = 42/67 (62%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTATFS+S+LQ +D                    IQ  ++ALGD++N +CHACIGGTNV 
Sbjct: 88  KTATFSVSVLQCLD--------------------IQG-LLALGDYMNVQCHACIGGTNVG 126

Query: 434 EDIRQLE 454
           EDIR+L+
Sbjct: 127 EDIRKLD 133


>UniRef50_UPI000065E01D Cluster: Homolog of Brachydanio rerio
           "Eukaryotic translation initiation factor 4A, isoform
           1A.; n=1; Takifugu rubripes|Rep: Homolog of Brachydanio
           rerio "Eukaryotic translation initiation factor 4A,
           isoform 1A. - Takifugu rubripes
          Length = 357

 Score = 85.8 bits (203), Expect = 1e-15
 Identities = 39/52 (75%), Positives = 47/52 (90%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           V++F+ M L E LLRGI+AYGFEKPSAIQQ+AI+PCI+G DVIAQ+QSGTGK
Sbjct: 20  VDSFEGMMLNENLLRGIFAYGFEKPSAIQQQAIVPCIKGFDVIAQSQSGTGK 71



 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 26/41 (63%), Positives = 33/41 (80%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIA 376
           KTAT+ I+ LQ+ID    + QA+ILAPTRELA QIQKVV++
Sbjct: 71  KTATYVIAALQRIDMMKEDTQAIILAPTRELANQIQKVVLS 111


>UniRef50_A5BNE7 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 339

 Score = 74.5 bits (175), Expect = 2e-12
 Identities = 34/51 (66%), Positives = 42/51 (82%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCH 406
           KTATF   ILQQ++  + +CQAL+LAPTRELAQQI+KV+ ALGDHLN K +
Sbjct: 62  KTATFCSGILQQLNEELTQCQALVLAPTRELAQQIEKVMRALGDHLNVKIY 112



 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 26/47 (55%), Positives = 31/47 (65%)
 Frame = +3

Query: 117 DMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           D N+    L  +   G EKPSAIQQ+ I+P  +G DVI QAQSGTGK
Sbjct: 16  DSNMNGLCLLNVLCEGIEKPSAIQQKGIVPFCKGLDVIQQAQSGTGK 62


>UniRef50_A7P4J7 Cluster: Chromosome chr4 scaffold_6, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr4 scaffold_6, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 128

 Score = 74.1 bits (174), Expect = 3e-12
 Identities = 35/46 (76%), Positives = 38/46 (82%)
 Frame = +3

Query: 120 MNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           M LKE LLRGIYAYG EKPSAIQQ+ I+P  +G DVI QAQSGTGK
Sbjct: 1   MGLKENLLRGIYAYGIEKPSAIQQKGIVPFCKGLDVIQQAQSGTGK 46


>UniRef50_Q8SQM5 Cluster: ATP-dependent RNA helicase eIF4A; n=1;
           Encephalitozoon cuniculi|Rep: ATP-dependent RNA helicase
           eIF4A - Encephalitozoon cuniculi
          Length = 425

 Score = 73.7 bits (173), Expect = 4e-12
 Identities = 36/62 (58%), Positives = 46/62 (74%), Gaps = 2/62 (3%)
 Frame = +3

Query: 78  LHTDWDQV--VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGT 251
           L +D  Q+   +T++D  LKE+LL+GIY+ GFE PS IQ+ AI P I GRD+ AQAQSGT
Sbjct: 27  LRSDSSQIRMFDTWEDYGLKEDLLKGIYSIGFETPSFIQKAAIQPIIDGRDIRAQAQSGT 86

Query: 252 GK 257
           GK
Sbjct: 87  GK 88



 Score = 37.1 bits (82), Expect = 0.44
 Identities = 24/67 (35%), Positives = 33/67 (49%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KT  F+++ LQ  D S    Q L+LA TRE+A Q       LG  + A+     GG+ + 
Sbjct: 88  KTGAFAVAALQICDMSQDVTQILVLASTREIAAQNAARFEDLGCFMGARVALLSGGSPIA 147

Query: 434 EDIRQLE 454
            D   LE
Sbjct: 148 ADKVALE 154


>UniRef50_UPI0000F2BC8C Cluster: PREDICTED: similar to eukaryotic
           translation initiation factor 4A, isoform 1,; n=2;
           Theria|Rep: PREDICTED: similar to eukaryotic translation
           initiation factor 4A, isoform 1, - Monodelphis domestica
          Length = 59

 Score = 66.5 bits (155), Expect = 6e-10
 Identities = 31/58 (53%), Positives = 39/58 (67%), Gaps = 1/58 (1%)
 Frame = +3

Query: 48  MDLREWTL-GHLHTDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQG 218
           M L EWTL G + +DW+++V++FDDMNL E LL GIYAYGFEK           CI+G
Sbjct: 1   MALMEWTLMGVIESDWNEIVDSFDDMNLSESLLCGIYAYGFEKAICHSVTCNSSCIKG 58


>UniRef50_A0BEU9 Cluster: Chromosome undetermined scaffold_102,
           whole genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_102,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 395

 Score = 66.1 bits (154), Expect = 8e-10
 Identities = 32/70 (45%), Positives = 48/70 (68%), Gaps = 3/70 (4%)
 Frame = +3

Query: 99  VVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK---LLLS 269
           +  TF+ M L++ELLRGI A+GF +P  +QQRA++P IQGRDV+ Q    TGK   + LS
Sbjct: 20  IQSTFESMKLRKELLRGINAFGFIRPLEVQQRALVPLIQGRDVVIQNFRSTGKTTVMSLS 79

Query: 270 LYRFYNKSIQ 299
           +   ++ S++
Sbjct: 80  VLSIFDLSVK 89



 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 25/63 (39%), Positives = 40/63 (63%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KT   S+S+L   D S+++ Q LIL  TR+L ++   +++ALG  LN   HAC  G +++
Sbjct: 72  KTTVMSLSVLSIFDLSVKKIQVLILQKTRKLTEENAGLIMALGKFLNVSIHACSEGNSIQ 131

Query: 434 EDI 442
           +DI
Sbjct: 132 DDI 134


>UniRef50_P39517 Cluster: ATP-dependent RNA helicase DHH1; n=103;
           Eukaryota|Rep: ATP-dependent RNA helicase DHH1 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 506

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 30/50 (60%), Positives = 38/50 (76%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           TF+D  LK ELL GI+  GFEKPS IQ+ AI   I GRD++A+A++GTGK
Sbjct: 47  TFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPVAITGRDILARAKNGTGK 96



 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 31/66 (46%), Positives = 41/66 (62%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTA F I  L+++   + + QALI+ PTRELA Q  +VV  LG H    C    GGTN+R
Sbjct: 96  KTAAFVIPTLEKVKPKLNKIQALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLR 155

Query: 434 EDIRQL 451
           +DI +L
Sbjct: 156 DDILRL 161


>UniRef50_Q0E2Q3 Cluster: Putative eukaryotic initiation factor
           4A-2; n=5; Oryza sativa|Rep: Putative eukaryotic
           initiation factor 4A-2 - Oryza sativa subsp. japonica
           (Rice)
          Length = 416

 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 30/61 (49%), Positives = 39/61 (63%)
 Frame = +2

Query: 257 TATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVRE 436
           T T    ILQ++D +  ECQAL+L PT +LA + Q V+  LG  L+AK HA  GGT+  E
Sbjct: 97  TVTLCCGILQRLDYASTECQALVLVPTHDLAHETQNVIGVLGQFLSAKAHAFCGGTSAHE 156

Query: 437 D 439
           D
Sbjct: 157 D 157



 Score = 36.3 bits (80), Expect = 0.77
 Identities = 18/51 (35%), Positives = 26/51 (50%)
 Frame = +3

Query: 99  VVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGT 251
           +V T     + E L+        +KPSA+ QR I+P   G D+I Q+  GT
Sbjct: 46  IVTTQGAQFISESLIGETQTKDLDKPSAVHQRGIVPLCNGLDIIQQSLFGT 96


>UniRef50_Q8SSD2 Cluster: ATP-DEPENDENT RNA HELICASE INVOLVED IN
           mRNA EXPORT FROM THE NUCLEUS; n=1; Encephalitozoon
           cuniculi|Rep: ATP-DEPENDENT RNA HELICASE INVOLVED IN
           mRNA EXPORT FROM THE NUCLEUS - Encephalitozoon cuniculi
          Length = 425

 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 29/55 (52%), Positives = 39/55 (70%)
 Frame = +3

Query: 99  VVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           V E F DM L +ELL+ IY  GFEKPS IQ+ AI   ++G +V+ Q++SGTGK +
Sbjct: 49  VAEHFSDMGLSDELLKAIYNQGFEKPSLIQKSAIPHILRGHNVVVQSKSGTGKTI 103


>UniRef50_Q5KJI2 Cluster: ATP-dependent RNA helicase DHH1; n=4;
           Dikarya|Rep: ATP-dependent RNA helicase DHH1 -
           Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 625

 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 27/49 (55%), Positives = 38/49 (77%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F+D  L+ ELL GIY  GFE+PS IQ++AI   + GRD++A+A++GTGK
Sbjct: 38  FEDFGLRRELLMGIYTAGFERPSPIQEQAIPMALTGRDILARAKNGTGK 86



 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 33/68 (48%), Positives = 44/68 (64%), Gaps = 1/68 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA+F I  L +I+TS+   QALIL PTRELA Q  +V   LG H+ N +     GGT +
Sbjct: 86  KTASFIIPTLNRINTSLSHIQALILVPTRELALQTSQVCKTLGAHIPNLQVMITTGGTTL 145

Query: 431 REDIRQLE 454
           R+DI +L+
Sbjct: 146 RDDILRLQ 153


>UniRef50_Q725W5 Cluster: ATP-dependent RNA helicase, DEAD/DEAH
           family; n=2; Desulfovibrio vulgaris subsp. vulgaris|Rep:
           ATP-dependent RNA helicase, DEAD/DEAH family -
           Desulfovibrio vulgaris (strain Hildenborough / ATCC
           29579 / NCIMB8303)
          Length = 532

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 30/52 (57%), Positives = 38/52 (73%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           VE+F D+ L+EELL+ I   GF +PS IQ  AI   ++GRDVI QAQ+GTGK
Sbjct: 4   VESFKDLPLEEELLKAIEELGFTEPSPIQSIAIPRLLEGRDVIGQAQTGTGK 55



 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 24/46 (52%), Positives = 31/46 (67%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL 391
           KTA F + +LQ+ID + R  QAL+L PTRELA Q+   + AL  HL
Sbjct: 55  KTAAFGLPLLQRIDAADRSVQALVLCPTRELALQVANGLTALAKHL 100


>UniRef50_Q54TF8 Cluster: DEAD-box RNA helicase; n=2; Dictyostelium
           discoideum|Rep: DEAD-box RNA helicase - Dictyostelium
           discoideum AX4
          Length = 465

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 29/53 (54%), Positives = 41/53 (77%), Gaps = 1/53 (1%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQG-RDVIAQAQSGTGK 257
           V+TF+++ LK ELL+G+YA G+ KPS IQ+ A+   IQ   ++IAQ+QSGTGK
Sbjct: 69  VKTFEELGLKPELLKGVYAMGYNKPSKIQEAALPIIIQSPNNLIAQSQSGTGK 121



 Score = 42.7 bits (96), Expect = 0.009
 Identities = 20/49 (40%), Positives = 31/49 (63%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAK 400
           KTA F++ +L  +D SI   QA+ ++PT+ELA Q  +V+  +G   N K
Sbjct: 121 KTAAFTLGMLNCVDPSINAPQAICISPTKELALQTFEVISKIGQFSNIK 169


>UniRef50_Q5BXU1 Cluster: SJCHGC08663 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC08663 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 193

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 2/54 (3%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQG--RDVIAQAQSGTGK 257
           V TF ++NLKE LL+GI A GF KPS IQ+RA+   I    +++IAQ+QSGTGK
Sbjct: 75  VRTFQELNLKEPLLKGIAAMGFYKPSTIQERALSSLISDNPQNMIAQSQSGTGK 128



 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 21/38 (55%), Positives = 28/38 (73%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKV 367
           KTATF +++L +I T +  CQ L +APTRELA QI+ V
Sbjct: 128 KTATFLLAMLSRIRTDVHYCQCLCMAPTRELALQIESV 165


>UniRef50_Q9UHL0 Cluster: ATP-dependent RNA helicase DDX25; n=111;
           Eumetazoa|Rep: ATP-dependent RNA helicase DDX25 - Homo
           sapiens (Human)
          Length = 483

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 30/54 (55%), Positives = 42/54 (77%), Gaps = 2/54 (3%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAI--MPCIQGRDVIAQAQSGTGK 257
           V+TF+++ LKEELL+GIYA GF +PS IQ+ A+  M     +++IAQ+QSGTGK
Sbjct: 96  VKTFEELRLKEELLKGIYAMGFNRPSKIQEMALPMMLAHPPQNLIAQSQSGTGK 149



 Score = 35.1 bits (77), Expect = 1.8
 Identities = 21/58 (36%), Positives = 29/58 (50%)
 Frame = +2

Query: 209 HPRTRCYRSSPVRNWKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALG 382
           HP       S     KTA F +++L +++      Q L LAPT ELA Q  +VV  +G
Sbjct: 134 HPPQNLIAQSQSGTGKTAAFVLAMLSRVNALELFPQCLCLAPTYELALQTGRVVEQMG 191


>UniRef50_A4V6K5 Cluster: DEAD box polypeptide 19 protein; n=3;
           Platyhelminthes|Rep: DEAD box polypeptide 19 protein -
           Dugesia japonica (Planarian)
          Length = 434

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 31/65 (47%), Positives = 45/65 (69%), Gaps = 2/65 (3%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCI--QGRDVIAQAQSGTGKLLLSLY 275
           V++F+D+ LK ELL GI + GF KPS+IQ+RA+   +  Q +++IAQ+QSGTGK    L 
Sbjct: 47  VKSFEDLQLKSELLNGISSMGFRKPSSIQERALPMLLENQPKNLIAQSQSGTGKTATFLL 106

Query: 276 RFYNK 290
              +K
Sbjct: 107 TMLSK 111



 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 22/47 (46%), Positives = 31/47 (65%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLN 394
           KTATF +++L +ID +   CQ L +APTREL  QI +V I +   +N
Sbjct: 100 KTATFLLTMLSKIDVNDPFCQCLCMAPTRELVNQIAEVAIIMSKFMN 146


>UniRef50_Q8XKJ8 Cluster: ATP-dependent RNA helicase; n=12;
           Clostridium|Rep: ATP-dependent RNA helicase -
           Clostridium perfringens
          Length = 528

 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 27/49 (55%), Positives = 35/49 (71%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           FDD+ LKE LL+ I   GFE+PS IQ  +I   ++G D+I QAQ+GTGK
Sbjct: 6   FDDLGLKESLLKAIKDMGFEEPSQIQAESIPVALEGHDIIGQAQTGTGK 54



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 27/69 (39%), Positives = 38/69 (55%), Gaps = 2/69 (2%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIREC--QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTN 427
           KTA F  +I+   D S ++   +ALILAPTRELA Q+ + ++ LG H         GG  
Sbjct: 54  KTAAFGCAIINNADFSGKKKSPKALILAPTRELAIQVNEELVRLGKHEKLSVLPIYGGQP 113

Query: 428 VREDIRQLE 454
           +   IR L+
Sbjct: 114 IDRQIRALK 122


>UniRef50_Q4T821 Cluster: Chromosome undetermined SCAF7914, whole
           genome shotgun sequence; n=3; Tetraodontidae|Rep:
           Chromosome undetermined SCAF7914, whole genome shotgun
           sequence - Tetraodon nigroviridis (Green puffer)
          Length = 502

 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 26/49 (53%), Positives = 37/49 (75%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F+D  LK ELL GI+  G+EKPS IQ+ +I   + GRD++A+A++GTGK
Sbjct: 91  FEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGK 139



 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 29/68 (42%), Positives = 43/68 (63%), Gaps = 1/68 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           K+  + I +L++ID      QAL+L PTRELA Q+ ++ I +  HL   K  A  GGTN+
Sbjct: 139 KSGAYLIPMLERIDLKKDHIQALVLVPTRELALQVSQISIQIAKHLGGVKVMATTGGTNL 198

Query: 431 REDIRQLE 454
           R+DI +L+
Sbjct: 199 RDDIMRLD 206


>UniRef50_Q8IV96 Cluster: DDX6 protein; n=8; Eukaryota|Rep: DDX6
           protein - Homo sapiens (Human)
          Length = 187

 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 26/49 (53%), Positives = 37/49 (75%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F+D  LK ELL GI+  G+EKPS IQ+ +I   + GRD++A+A++GTGK
Sbjct: 98  FEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGK 146



 Score = 34.7 bits (76), Expect = 2.4
 Identities = 13/38 (34%), Positives = 25/38 (65%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKV 367
           K+  + I +L+++D      QA+++ PTRELA Q+ ++
Sbjct: 146 KSGAYLIPLLERLDLKKDNIQAMVIVPTRELALQVSQI 183


>UniRef50_Q7QTB2 Cluster: GLP_15_13424_14974; n=2; Giardia
           intestinalis|Rep: GLP_15_13424_14974 - Giardia lamblia
           ATCC 50803
          Length = 516

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 26/49 (53%), Positives = 35/49 (71%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D NL+EE+L+ I + GFE PS +Q  AI P ++ +DVI QA+SG GK
Sbjct: 130 FSDFNLREEVLQAIISNGFESPSDVQSMAIPPALEHKDVICQAKSGKGK 178



 Score = 37.5 bits (83), Expect = 0.33
 Identities = 29/73 (39%), Positives = 36/73 (49%), Gaps = 6/73 (8%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSI--RECQALILAPTRELAQQIQK----VVIALGDHLNAKCHACI 415
           KTA F +S+L  ID      + QAL+L  T ELA QI K      I L D +  K    I
Sbjct: 178 KTAVFVLSLLHMIDPQAAPHKVQALVLCNTHELAMQIYKEFTRFAINLPD-IKDKILCAI 236

Query: 416 GGTNVREDIRQLE 454
           GG  V   +R L+
Sbjct: 237 GGVTVSLHVRALK 249


>UniRef50_UPI0001509D93 Cluster: DEAD/DEAH box helicase family
           protein; n=1; Tetrahymena thermophila SB210|Rep:
           DEAD/DEAH box helicase family protein - Tetrahymena
           thermophila SB210
          Length = 476

 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 25/61 (40%), Positives = 41/61 (67%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSLYRFYN 287
           +F+D +LK++LLR +   GFE+PS +Q + I   I G+DV+ QA++GTGK  + +    N
Sbjct: 39  SFNDFSLKQDLLRSVKEAGFERPSEVQHQCIPNAIHGKDVLCQAKAGTGKTAVFVLSVLN 98

Query: 288 K 290
           +
Sbjct: 99  Q 99



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 26/67 (38%), Positives = 33/67 (49%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTA F +S+L Q+    +    L+L  TRELA QI+     LG   N K  A  GG    
Sbjct: 88  KTAVFVLSVLNQLPDDAKPFSCLVLCHTRELAFQIKNEFKRLGKFTNFKVKAVYGGVEES 147

Query: 434 EDIRQLE 454
            DI  L+
Sbjct: 148 VDIHTLK 154


>UniRef50_Q67NW1 Cluster: ATP-dependent RNA helicase; n=5;
           Firmicutes|Rep: ATP-dependent RNA helicase -
           Symbiobacterium thermophilum
          Length = 526

 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 27/50 (54%), Positives = 37/50 (74%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           TF D+ L E++L+ +   GFE+PS IQ +AI   +QG+DVI QAQ+GTGK
Sbjct: 7   TFRDLALSEKVLKALDDMGFEEPSPIQAQAIPALLQGKDVIGQAQTGTGK 56



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 26/66 (39%), Positives = 38/66 (57%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTA F + I++++    R  QAL+L PTRELA Q+ + +  +G H   K  A  GG ++ 
Sbjct: 56  KTAAFGVPIVERLVPGQRAVQALVLTPTRELAIQVAEEITKIGRHARVKTIAIYGGQSIE 115

Query: 434 EDIRQL 451
             IR L
Sbjct: 116 RQIRSL 121


>UniRef50_A2DVG1 Cluster: DEAD/DEAH box helicase family protein;
           n=3; Trichomonas vaginalis G3|Rep: DEAD/DEAH box
           helicase family protein - Trichomonas vaginalis G3
          Length = 478

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 31/59 (52%), Positives = 38/59 (64%), Gaps = 2/59 (3%)
 Frame = +3

Query: 87  DWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAI--MPCIQGRDVIAQAQSGTGK 257
           +W   V+ FD M+L   LL+G+Y+YGF  PS IQ  AI  +     R VIAQAQSGTGK
Sbjct: 85  NWTTRVDDFDQMDLPPALLQGVYSYGFRAPSEIQAIAIGAIRDPSNRHVIAQAQSGTGK 143



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 24/46 (52%), Positives = 30/46 (65%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL 391
           KT  FSI +L +ID S +  QAL+LAPTRELA QI  V   +G  +
Sbjct: 143 KTGAFSIGVLSKIDVSQKTTQALVLAPTRELATQIFNVFKEIGSRI 188


>UniRef50_P20449 Cluster: ATP-dependent RNA helicase DBP5; n=23;
           Dikarya|Rep: ATP-dependent RNA helicase DBP5 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 482

 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 28/53 (52%), Positives = 40/53 (75%), Gaps = 2/53 (3%)
 Frame = +3

Query: 105 ETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQG--RDVIAQAQSGTGK 257
           ++FD++ L  ELL+GIYA  F+KPS IQ+RA+   +    R++IAQ+QSGTGK
Sbjct: 92  KSFDELGLAPELLKGIYAMKFQKPSKIQERALPLLLHNPPRNMIAQSQSGTGK 144



 Score = 39.5 bits (88), Expect = 0.083
 Identities = 19/43 (44%), Positives = 30/43 (69%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALG 382
           KTA FS+++L +++      QA+ LAP+RELA+Q  +VV  +G
Sbjct: 144 KTAAFSLTMLTRVNPEDASPQAICLAPSRELARQTLEVVQEMG 186


>UniRef50_Q893G8 Cluster: ATP-dependent RNA helicase; n=4;
           Clostridiales|Rep: ATP-dependent RNA helicase -
           Clostridium tetani
          Length = 386

 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 32/75 (42%), Positives = 44/75 (58%), Gaps = 2/75 (2%)
 Frame = +2

Query: 236 SPVRNWKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDH--LNAKCHA 409
           SP  + KT  + + I Q+IDTS RE QA+ILAPT ELA QI K +  L  +  ++     
Sbjct: 47  SPTGSGKTLAYLLPIFQKIDTSKREMQAIILAPTHELAMQINKEIQLLSGNSKVSVTSTP 106

Query: 410 CIGGTNVREDIRQLE 454
            IG  NV+  I +L+
Sbjct: 107 IIGNANVKRQIEKLK 121



 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 22/64 (34%), Positives = 38/64 (59%)
 Frame = +3

Query: 99  VVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSLYR 278
           ++E+FD + L + L+ G+   G  KP+ IQ + I   ++ +DVI Q+ +G+GK L  L  
Sbjct: 1   MIESFDKLGLNQNLIEGLKQEGINKPTDIQIKTIPLALENKDVIGQSPTGSGKTLAYLLP 60

Query: 279 FYNK 290
            + K
Sbjct: 61  IFQK 64


>UniRef50_Q11QF9 Cluster: Inducible ATP-independent RNA helicase;
           n=1; Cytophaga hutchinsonii ATCC 33406|Rep: Inducible
           ATP-independent RNA helicase - Cytophaga hutchinsonii
           (strain ATCC 33406 / NCIMB 9469)
          Length = 457

 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 27/68 (39%), Positives = 41/68 (60%), Gaps = 1/68 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F + +LQQI+ S+++ Q L+L PTREL QQ+ K +     ++      A  GG  +
Sbjct: 52  KTAAFGLPVLQQINPSLQQTQVLVLVPTRELGQQVAKDLFVFSRYIVRIHTEAVYGGKKI 111

Query: 431 REDIRQLE 454
            E I++LE
Sbjct: 112 EEQIKKLE 119



 Score = 39.1 bits (87), Expect = 0.11
 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 1/51 (1%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQG-RDVIAQAQSGTGK 257
           TF D+ L   LL+ +       PS IQQ+AI   +   ++V+  AQ+GTGK
Sbjct: 2   TFSDLGLNAALLQSLSENNISSPSEIQQKAIPVILNSTKNVVGVAQTGTGK 52


>UniRef50_A6NQG8 Cluster: Putative uncharacterized protein; n=2;
           Bacteroidales|Rep: Putative uncharacterized protein -
           Bacteroides capillosus ATCC 29799
          Length = 636

 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 24/50 (48%), Positives = 36/50 (72%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           TF ++ L + +L+ +   G+EKPS IQ++AI P + GRDV+  AQ+GTGK
Sbjct: 2   TFRELGLTQSILKALAELGYEKPSPIQEKAIPPALAGRDVLGCAQTGTGK 51



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 27/70 (38%), Positives = 38/70 (54%), Gaps = 3/70 (4%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSI---RECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 424
           KT  F+  ILQ++   I   R  ++LIL PTRELA QIQ+   A G HL  +     GG 
Sbjct: 51  KTCAFAAPILQRLGGDIPAGRPIRSLILTPTRELALQIQESFEAYGKHLPLRSAVIFGGV 110

Query: 425 NVREDIRQLE 454
             +  + +L+
Sbjct: 111 GQQPQVDKLK 120


>UniRef50_Q23U16 Cluster: DEAD/DEAH box helicase family protein;
           n=1; Tetrahymena thermophila SB210|Rep: DEAD/DEAH box
           helicase family protein - Tetrahymena thermophila SB210
          Length = 475

 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 25/38 (65%), Positives = 31/38 (81%)
 Frame = +3

Query: 144 RGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           + + +YGFEKPS IQQ  I+P I+G+D IAQAQSGTGK
Sbjct: 47  QNVLSYGFEKPSPIQQCGIIPIIKGKDTIAQAQSGTGK 84



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 31/47 (65%), Positives = 35/47 (74%), Gaps = 1/47 (2%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQ-IQKVVIALGDHL 391
           KTATFSI+ LQ IDTS    QALILAPTRELAQQ I ++   LG +L
Sbjct: 84  KTATFSIATLQVIDTSSPHTQALILAPTRELAQQTITRIFFILGVNL 130



 Score = 33.9 bits (74), Expect = 4.1
 Identities = 13/31 (41%), Positives = 22/31 (70%)
 Frame = +2

Query: 359 QKVVIALGDHLNAKCHACIGGTNVREDIRQL 451
           +KV++ LG+ L    +AC GGT+ +ED ++L
Sbjct: 186 KKVIMYLGEFLKVSAYACTGGTDPKEDRKRL 216


>UniRef50_UPI0000566899 Cluster: UPI0000566899 related cluster; n=1;
           Mus musculus|Rep: UPI0000566899 UniRef100 entry - Mus
           musculus
          Length = 449

 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 25/68 (36%), Positives = 44/68 (64%), Gaps = 1/68 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           K+  + I +L+++D      QA+++ PTRELA Q+ ++ I +  H+  AK  A  GGTN+
Sbjct: 131 KSGAYLIPLLERLDLKKDNIQAMVIVPTRELALQVSQICIQVSKHMGGAKVMATTGGTNL 190

Query: 431 REDIRQLE 454
           R+D+ +L+
Sbjct: 191 RDDVMRLD 198



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 32/77 (41%), Positives = 49/77 (63%)
 Frame = +3

Query: 27  RRIKVVTMDLREWTLGHLHTDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMP 206
           + +K+   DLR  TL    T  ++    F+D  LK ELL GI+  G+E PS+IQ+ +I  
Sbjct: 60  KTLKLPPKDLRIKTLDVTSTKGNE----FEDYCLKRELLIGIFEMGWE-PSSIQEESIPI 114

Query: 207 CIQGRDVIAQAQSGTGK 257
            + GRD++A+A++GTGK
Sbjct: 115 ALSGRDILARAKNGTGK 131


>UniRef50_Q4S6B9 Cluster: Chromosome 9 SCAF14729, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 9 SCAF14729, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 457

 Score = 56.4 bits (130), Expect = 7e-07
 Identities = 26/54 (48%), Positives = 40/54 (74%), Gaps = 2/54 (3%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRA--IMPCIQGRDVIAQAQSGTGK 257
           V++F+++ LK ELL+G+Y  GF +PS IQ+ A  +M     +++IAQ+QSGTGK
Sbjct: 37  VKSFEELRLKPELLKGVYQMGFNRPSRIQENALPLMMAQPAQNLIAQSQSGTGK 90



 Score = 32.7 bits (71), Expect = 9.5
 Identities = 17/43 (39%), Positives = 28/43 (65%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALG 382
           KTA F +++L  ++ + +  Q L +APT ELA QI +V+  +G
Sbjct: 90  KTAAFCLAMLGIVNPADKWPQCLCIAPTYELALQIGQVLEQMG 132


>UniRef50_A5E6W6 Cluster: ATP-dependent rRNA helicase RRP3; n=4;
           Saccharomycetaceae|Rep: ATP-dependent rRNA helicase RRP3
           - Lodderomyces elongisporus (Yeast) (Saccharomyces
           elongisporus)
          Length = 504

 Score = 56.4 bits (130), Expect = 7e-07
 Identities = 30/66 (45%), Positives = 41/66 (62%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTA F+I ILQ + T+ +   AL+LAPTRELA QI++   ALG  +  +    IGG ++ 
Sbjct: 148 KTAAFAIPILQTLYTAAQPYYALVLAPTRELAFQIKETFDALGSSMGLRSVCIIGGMSMM 207

Query: 434 EDIRQL 451
           E  R L
Sbjct: 208 EQARDL 213



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 19/52 (36%), Positives = 34/52 (65%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           V++F + +L  ELL  I +  + +P+ IQ  AI   +QG+D++  A++G+GK
Sbjct: 97  VQSFTEFDLVPELLESIQSLKYTQPTPIQAAAIPHALQGKDIVGIAETGSGK 148


>UniRef50_Q5KBP5 Cluster: ATP-dependent RNA helicase DBP5; n=3;
           Filobasidiella neoformans|Rep: ATP-dependent RNA
           helicase DBP5 - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 546

 Score = 56.4 bits (130), Expect = 7e-07
 Identities = 26/54 (48%), Positives = 41/54 (75%), Gaps = 2/54 (3%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQG--RDVIAQAQSGTGK 257
           V++F ++NL E+L++GI A GF+KPS IQ++A+   +    R++I Q+QSGTGK
Sbjct: 147 VQSFKELNLHEDLMKGIIAAGFQKPSKIQEKALPLLLSNPPRNLIGQSQSGTGK 200



 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 22/57 (38%), Positives = 37/57 (64%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 424
           KTA F++++L ++D +I   QA+ +AP+RELA+QIQ+V+  +G          I G+
Sbjct: 200 KTAAFTLNMLSRVDPTIPTPQAICIAPSRELARQIQEVIDQIGQFTQVGTFLAIPGS 256


>UniRef50_Q0RTL3 Cluster: Cold-shock DeaD box ATP-dependent RNA
           helicase; n=2; Bacteria|Rep: Cold-shock DeaD box
           ATP-dependent RNA helicase - Frankia alni (strain
           ACN14a)
          Length = 608

 Score = 56.0 bits (129), Expect = 9e-07
 Identities = 24/52 (46%), Positives = 37/52 (71%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           V  F ++ L+ ELLR + A G+E+P+ IQ+ A+ P + GRD++ QA +GTGK
Sbjct: 56  VAGFAELALRPELLRSLAALGYEEPTPIQREAVPPLVAGRDLLGQAATGTGK 107



 Score = 42.3 bits (95), Expect = 0.012
 Identities = 24/69 (34%), Positives = 36/69 (52%), Gaps = 3/69 (4%)
 Frame = +2

Query: 254 KTATFSISILQQID---TSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 424
           KTA F++ +L ++    T     QAL+L PTRELA Q+ + +   G  L A+     GG 
Sbjct: 107 KTAAFALPLLHRLTDDRTGDHGPQALVLVPTRELAVQVSEAIHRYGRDLGARVLPVYGGA 166

Query: 425 NVREDIRQL 451
            +   +R L
Sbjct: 167 PIGRQVRAL 175


>UniRef50_Q98RE0 Cluster: ATP-DEPENDENT RNA HELICASE; n=1;
           Mycoplasma pulmonis|Rep: ATP-DEPENDENT RNA HELICASE -
           Mycoplasma pulmonis
          Length = 480

 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 23/49 (46%), Positives = 34/49 (69%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F  MN+K E+L+ +   GFEKP+ IQ+  +    +G+D+I QAQ+GTGK
Sbjct: 3   FTQMNIKSEILKSLDEIGFEKPTKIQEAVLPFAFEGKDIIGQAQTGTGK 51



 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 26/58 (44%), Positives = 35/58 (60%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTN 427
           KTA F+I IL  +D SI   Q L++APTRELA QI   +  LG +  +K    +GG +
Sbjct: 51  KTAAFAIPILSNLDCSINRIQHLVIAPTRELANQIYDQLNILGKYTCSKIALILGGVS 108


>UniRef50_Q26CN9 Cluster: ATP-dependent RNA helicase; n=1;
           Flavobacteria bacterium BBFL7|Rep: ATP-dependent RNA
           helicase - Flavobacteria bacterium BBFL7
          Length = 644

 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 31/67 (46%), Positives = 38/67 (56%), Gaps = 1/67 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F + +L  ID + RE QALILAPTRELAQQI   +  +  HL         GG N+
Sbjct: 64  KTAAFGLPLLDLIDVNSREVQALILAPTRELAQQICGQMEQMSKHLGKLNVVPVFGGANI 123

Query: 431 REDIRQL 451
              IR +
Sbjct: 124 MNQIRDI 130



 Score = 41.5 bits (93), Expect = 0.021
 Identities = 26/76 (34%), Positives = 42/76 (55%), Gaps = 7/76 (9%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQ-GRDVIAQAQSGTGKL------ 260
           ++ F+ + L + LL G+   GFE P+ IQQ++I   ++   D I  AQ+GTGK       
Sbjct: 12  LKNFEVLGLSQPLLNGLADMGFENPTEIQQQSIPILLKHDGDFIGLAQTGTGKTAAFGLP 71

Query: 261 LLSLYRFYNKSIQAFV 308
           LL L    ++ +QA +
Sbjct: 72  LLDLIDVNSREVQALI 87


>UniRef50_A2EPG4 Cluster: DEAD/DEAH box helicase family protein;
           n=1; Trichomonas vaginalis G3|Rep: DEAD/DEAH box
           helicase family protein - Trichomonas vaginalis G3
          Length = 389

 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 26/54 (48%), Positives = 38/54 (70%)
 Frame = +3

Query: 96  QVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +V  T++ M LK EL+  I   G+EKPS IQQRAI    QG++++ Q+Q+G+GK
Sbjct: 17  EVYPTWESMKLKPELIEAIKKNGWEKPSPIQQRAIYIISQGKNIMFQSQNGSGK 70



 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 25/67 (37%), Positives = 42/67 (62%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTATFSI  L ++  + +  + +I++PTRELA Q +  + +LG    A   AC+GG ++ 
Sbjct: 70  KTATFSIGTLARLRLTSKTTELIIVSPTRELAIQTENTLKSLG----ANTRACVGGNSLG 125

Query: 434 EDIRQLE 454
            D++ L+
Sbjct: 126 ADVKALQ 132


>UniRef50_Q7VFA9 Cluster: ATP-dependent RNA helicase DeaD; n=6;
           Helicobacteraceae|Rep: ATP-dependent RNA helicase DeaD -
           Helicobacter hepaticus
          Length = 530

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 26/54 (48%), Positives = 37/54 (68%)
 Frame = +3

Query: 96  QVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           Q  + FD   LK+ +L+GI   GF  PS +Q ++I   +QG+D+IAQAQ+GTGK
Sbjct: 42  QDTQGFDVFGLKDFVLKGIREAGFSTPSPVQSQSIPIILQGKDLIAQAQTGTGK 95



 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 25/67 (37%), Positives = 39/67 (58%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTA F+I IL  ++ + ++ +ALI+ PTRELA QI + ++ LG     K     GG +++
Sbjct: 95  KTAAFAIPILNTLNRN-KDIEALIITPTRELAMQISEEILKLGRFGRIKTICMYGGQSIK 153

Query: 434 EDIRQLE 454
                LE
Sbjct: 154 RQCDLLE 160


>UniRef50_P21507 Cluster: ATP-dependent RNA helicase srmB; n=82;
           Proteobacteria|Rep: ATP-dependent RNA helicase srmB -
           Escherichia coli (strain K12)
          Length = 444

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 25/52 (48%), Positives = 33/52 (63%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           V TF ++ L E LL  +   GF +P+AIQ  AI P + GRDV+  A +GTGK
Sbjct: 3   VTTFSELELDESLLEALQDKGFTRPTAIQAAAIPPALDGRDVLGSAPTGTGK 54


>UniRef50_Q6AMK6 Cluster: Probable ATP-dependent RNA helicase; n=1;
           Desulfotalea psychrophila|Rep: Probable ATP-dependent
           RNA helicase - Desulfotalea psychrophila
          Length = 632

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 30/73 (41%), Positives = 43/73 (58%), Gaps = 6/73 (8%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKL------LLS 269
           +F D NLK +L+  +   GF +P+ IQ++AI   + G D+I QAQ+GTGK       LL+
Sbjct: 56  SFTDFNLKSDLVANLVKLGFSQPTPIQEKAIPLLLAGSDLIGQAQTGTGKTAAFGLPLLN 115

Query: 270 LYRFYNKSIQAFV 308
              F  K +QA V
Sbjct: 116 NIDFSKKCVQALV 128



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 21/35 (60%), Positives = 26/35 (74%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQI 358
           KTA F + +L  ID S +  QAL+LAPTRELAQQ+
Sbjct: 105 KTAAFGLPLLNNIDFSKKCVQALVLAPTRELAQQV 139


>UniRef50_A7R616 Cluster: Chromosome undetermined scaffold_1128,
           whole genome shotgun sequence; n=1; Vitis vinifera|Rep:
           Chromosome undetermined scaffold_1128, whole genome
           shotgun sequence - Vitis vinifera (Grape)
          Length = 372

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 24/66 (36%), Positives = 43/66 (65%)
 Frame = +3

Query: 93  DQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           D+  +TF+++ L+  L+R +   G EKP++IQ+ AI   ++G+DV+A+A++G+GK    L
Sbjct: 20  DEESKTFEELGLEPSLIRALIKMGIEKPTSIQEVAIPLILEGKDVVARAKTGSGKTFAYL 79

Query: 273 YRFYNK 290
                K
Sbjct: 80  LPLLQK 85


>UniRef50_P38712 Cluster: ATP-dependent rRNA helicase RRP3; n=6;
           Ascomycota|Rep: ATP-dependent rRNA helicase RRP3 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 501

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 23/59 (38%), Positives = 39/59 (66%)
 Frame = +3

Query: 81  HTDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +T+ D+  E+F ++NL  EL++      + KP+ IQ +AI P ++G D+I  AQ+G+GK
Sbjct: 73  NTNEDESFESFSELNLVPELIQACKNLNYSKPTPIQSKAIPPALEGHDIIGLAQTGSGK 131



 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 27/66 (40%), Positives = 38/66 (57%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTA F+I IL ++        A ILAPTRELAQQI++   +LG  +  +    +GG N+ 
Sbjct: 131 KTAAFAIPILNRLWHDQEPYYACILAPTRELAQQIKETFDSLGSLMGVRSTCIVGGMNMM 190

Query: 434 EDIRQL 451
           +  R L
Sbjct: 191 DQARDL 196


>UniRef50_Q9SW44 Cluster: DEAD-box ATP-dependent RNA helicase 16;
           n=5; Magnoliophyta|Rep: DEAD-box ATP-dependent RNA
           helicase 16 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 626

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 25/70 (35%), Positives = 43/70 (61%)
 Frame = +3

Query: 93  DQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           ++  ++F+++ L   L+R +   G EKP+ IQQ AI   ++G+DV+A+A++G+GK L  L
Sbjct: 42  EEAPKSFEELGLDSRLIRALTKKGIEKPTLIQQSAIPYILEGKDVVARAKTGSGKTLAYL 101

Query: 273 YRFYNKSIQA 302
                K   A
Sbjct: 102 LPLLQKLFSA 111


>UniRef50_Q1IMK6 Cluster: DEAD/DEAH box helicase-like; n=1;
           Acidobacteria bacterium Ellin345|Rep: DEAD/DEAH box
           helicase-like - Acidobacteria bacterium (strain
           Ellin345)
          Length = 423

 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 25/56 (44%), Positives = 38/56 (67%)
 Frame = +3

Query: 96  QVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           Q + TF+DM L + L + + A  F  P+ +Q++AI P + GRD++A AQ+GTGK L
Sbjct: 24  QRLTTFNDMPLSDVLKQRLEAAQFINPTPVQEKAIPPALDGRDILATAQTGTGKTL 79



 Score = 38.3 bits (85), Expect = 0.19
 Identities = 25/67 (37%), Positives = 32/67 (47%), Gaps = 1/67 (1%)
 Frame = +2

Query: 254 KTATFSISILQQI-DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 430
           KT  F I  L+ + DT     Q LIL PTRELA Q+  V   L           +GGT+ 
Sbjct: 77  KTLAFIIPALEMLRDTEPCGVQVLILVPTRELAMQVHGVYEQLKGKKLKSAALVMGGTSE 136

Query: 431 REDIRQL 451
           R  I+ +
Sbjct: 137 RNQIQSI 143


>UniRef50_P25888 Cluster: Putative ATP-dependent RNA helicase rhlE;
           n=122; cellular organisms|Rep: Putative ATP-dependent
           RNA helicase rhlE - Escherichia coli (strain K12)
          Length = 454

 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 22/50 (44%), Positives = 36/50 (72%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +FD + L  ++LR +   G+ +P+ IQQ+AI   ++GRD++A AQ+GTGK
Sbjct: 2   SFDSLGLSPDILRAVAEQGYREPTPIQQQAIPAVLEGRDLMASAQTGTGK 51



 Score = 40.3 bits (90), Expect = 0.047
 Identities = 26/72 (36%), Positives = 38/72 (52%), Gaps = 6/72 (8%)
 Frame = +2

Query: 254 KTATFSISILQQIDT------SIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI 415
           KTA F++ +LQ + T        R  +ALIL PTRELA QI + V     +LN +     
Sbjct: 51  KTAGFTLPLLQHLITRQPHAKGRRPVRALILTPTRELAAQIGENVRDYSKYLNIRSLVVF 110

Query: 416 GGTNVREDIRQL 451
           GG ++   + +L
Sbjct: 111 GGVSINPQMMKL 122


>UniRef50_UPI00005A557C Cluster: PREDICTED: similar to eukaryotic
           translation initiation factor 4A, isoform 1; n=1; Canis
           lupus familiaris|Rep: PREDICTED: similar to eukaryotic
           translation initiation factor 4A, isoform 1 - Canis
           familiaris
          Length = 430

 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 30/52 (57%), Positives = 34/52 (65%)
 Frame = +2

Query: 212 PRTRCYRSSPVRNWKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKV 367
           P  R    SP     TATF+ISILQQID  ++  +A  LAPTR LAQQIQKV
Sbjct: 177 PCLRYISCSPSGTGNTATFAISILQQIDLDLKATKASGLAPTRVLAQQIQKV 228


>UniRef50_Q6F0U0 Cluster: ATP-dependent RNA helicase; n=1;
           Mesoplasma florum|Rep: ATP-dependent RNA helicase -
           Mesoplasma florum (Acholeplasma florum)
          Length = 666

 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 28/68 (41%), Positives = 44/68 (64%), Gaps = 1/68 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA+F + IL++I+ + R  QA+I+APTRELA QI   +   G  + N      IGG ++
Sbjct: 51  KTASFVLPILEKIEPNKRRVQAVIMAPTRELAMQIVNQIRIFGSRIENLVIAPLIGGADM 110

Query: 431 REDIRQLE 454
           R+ I++L+
Sbjct: 111 RDQIKRLK 118



 Score = 36.7 bits (81), Expect = 0.58
 Identities = 15/50 (30%), Positives = 31/50 (62%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           TF ++ L +++L  +    F + + IQ RAI   ++G+++  ++ +GTGK
Sbjct: 2   TFKELQLSDKVLVALEKANFNEATEIQARAIPLFLEGKNIFGKSSTGTGK 51


>UniRef50_Q1I3W1 Cluster: ATP-dependent RNA helicase RhlE, DEAD box
           family; n=21; Pseudomonadaceae|Rep: ATP-dependent RNA
           helicase RhlE, DEAD box family - Pseudomonas entomophila
           (strain L48)
          Length = 634

 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 24/50 (48%), Positives = 35/50 (70%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +F  + L E L+R I A G+ +P+ +QQRAI   +QGRD++  AQ+GTGK
Sbjct: 2   SFASLGLSEALVRAIEAAGYTQPTPVQQRAIPAVLQGRDLMVAAQTGTGK 51


>UniRef50_A4FZ46 Cluster: DEAD/DEAH box helicase domain protein;
           n=4; Euryarchaeota|Rep: DEAD/DEAH box helicase domain
           protein - Methanococcus maripaludis
          Length = 541

 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 29/66 (43%), Positives = 38/66 (57%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTA F I IL+ ID S R  QALILAPTRELA Q+ + + ++            GG ++ 
Sbjct: 53  KTAAFGIPILETIDESSRNTQALILAPTRELAIQVAEEIDSIKGSKRLNVFPVYGGQSID 112

Query: 434 EDIRQL 451
             IR+L
Sbjct: 113 RQIREL 118



 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 23/53 (43%), Positives = 37/53 (69%), Gaps = 1/53 (1%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQG-RDVIAQAQSGTGK 257
           +E+F ++ L +E+L  +   GF  P+ IQ++AI   I+G RD++ QAQ+GTGK
Sbjct: 1   MESFKNLGLSDEILEALEKKGFTTPTPIQEQAIPILIEGKRDIVGQAQTGTGK 53


>UniRef50_Q6MN50 Cluster: ATP-dependent RNA helicase; n=1;
           Bdellovibrio bacteriovorus|Rep: ATP-dependent RNA
           helicase - Bdellovibrio bacteriovorus
          Length = 656

 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 24/63 (38%), Positives = 39/63 (61%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTA F I +++ ID+++++ QAL+L+PTRELA Q+ + +  LG     +     GG + R
Sbjct: 95  KTAAFGIPLIENIDSTVKDTQALVLSPTRELALQVAEQLTLLGKKKGVRVVTIYGGASYR 154

Query: 434 EDI 442
             I
Sbjct: 155 TQI 157


>UniRef50_A0Z0M4 Cluster: ATP-dependent RNA helicase; n=1; marine
           gamma proteobacterium HTCC2080|Rep: ATP-dependent RNA
           helicase - marine gamma proteobacterium HTCC2080
          Length = 582

 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 26/67 (38%), Positives = 41/67 (61%), Gaps = 1/67 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNA-KCHACIGGTNV 430
           KTA F++ IL  ID  +R  QAL+L PTRELAQQ+ +   + G  +   +  +  GG ++
Sbjct: 59  KTAAFALPILANIDVKVRSPQALVLCPTRELAQQVAEAFRSYGRGMGGLRILSIFGGADM 118

Query: 431 REDIRQL 451
           R+ ++ L
Sbjct: 119 RQQLKSL 125



 Score = 39.5 bits (88), Expect = 0.083
 Identities = 18/49 (36%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F+ + L + L   + + G+E  + IQ   I   ++GRDV+  AQ+GTGK
Sbjct: 11  FNSLGLPDFLQENLQSLGYETATPIQAGTIPLLLEGRDVVGLAQTGTGK 59


>UniRef50_A5B2H1 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 377

 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 24/66 (36%), Positives = 42/66 (63%)
 Frame = +3

Query: 93  DQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           D+  +TF+++ L+  L+R +   G EKP+ IQ+ AI   ++G+DV+A+A++G+GK    L
Sbjct: 20  DEESKTFEELGLEPSLIRALIKKGIEKPTPIQEVAIPLILEGKDVVARAKTGSGKTFAYL 79

Query: 273 YRFYNK 290
                K
Sbjct: 80  LPLLQK 85


>UniRef50_Q8MYE9 Cluster: Similar to Mus musculus (Mouse). DEAD-box
           corepressor DP103 alpha; n=2; Dictyostelium
           discoideum|Rep: Similar to Mus musculus (Mouse).
           DEAD-box corepressor DP103 alpha - Dictyostelium
           discoideum (Slime mold)
          Length = 837

 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 25/53 (47%), Positives = 40/53 (75%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLL 266
           TF ++ L++E+L+G+   G+++PS IQ +AI   I G D+IAQA+SGTGK ++
Sbjct: 44  TFSELLLQKEVLKGLEDGGYQRPSPIQLKAIPLGISGVDLIAQAKSGTGKTIV 96



 Score = 37.1 bits (82), Expect = 0.44
 Identities = 19/43 (44%), Positives = 27/43 (62%), Gaps = 1/43 (2%)
 Frame = +2

Query: 302 IRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 427
           IR+   LI+APTRE+A QI+ V+ ++  +    KC   IGG N
Sbjct: 147 IRKPLVLIIAPTREIAVQIKDVIKSISKYCKRIKCEVFIGGLN 189


>UniRef50_Q16JA8 Cluster: DEAD box ATP-dependent RNA helicase; n=1;
           Aedes aegypti|Rep: DEAD box ATP-dependent RNA helicase -
           Aedes aegypti (Yellowfever mosquito)
          Length = 727

 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 23/61 (37%), Positives = 40/61 (65%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSLYRFYN 287
           +F D  L ++ L G+    + KP+AIQ+ +I+P +QG+D++A A++G+GK L  L   + 
Sbjct: 63  SFSDFPLSKKTLGGLKQGQYHKPTAIQRESILPALQGKDILAAAKTGSGKTLAFLIPVFE 122

Query: 288 K 290
           K
Sbjct: 123 K 123



 Score = 35.1 bits (77), Expect = 1.8
 Identities = 23/70 (32%), Positives = 37/70 (52%), Gaps = 4/70 (5%)
 Frame = +2

Query: 254 KTATFSISILQQIDTS----IRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 421
           KT  F I + +++ T+    +    ALI+ PTRELA QI + V  +G   +      IGG
Sbjct: 112 KTLAFLIPVFEKLYTNQWTKLDGLGALIITPTRELALQIFETVAKIGKLHDFTTGLIIGG 171

Query: 422 TNVREDIRQL 451
            N++ +  +L
Sbjct: 172 QNLKAEKNRL 181


>UniRef50_Q9KAA6 Cluster: ATP-dependent RNA helicase; n=5;
           Firmicutes|Rep: ATP-dependent RNA helicase - Bacillus
           halodurans
          Length = 539

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 24/49 (48%), Positives = 34/49 (69%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F+++ + EE+ + I   GFE+PS IQ +AI   + G DVI QAQ+GTGK
Sbjct: 8   FNELQIGEEIKKAIIEMGFEEPSPIQAKAIPAILAGGDVIGQAQTGTGK 56



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 25/67 (37%), Positives = 37/67 (55%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTA F I +++++ T  R  QALIL PTRELA Q+   +  L  H   +     GG ++ 
Sbjct: 56  KTAAFGIPVVEKVSTG-RHVQALILTPTRELAIQVSGEIQKLSKHKKIRTLPIYGGQSIV 114

Query: 434 EDIRQLE 454
             I+ L+
Sbjct: 115 HQIKALK 121


>UniRef50_Q03YT1 Cluster: Superfamily II DNA and RNA helicase; n=1;
           Leuconostoc mesenteroides subsp. mesenteroides ATCC
           8293|Rep: Superfamily II DNA and RNA helicase -
           Leuconostoc mesenteroides subsp. mesenteroides (strain
           ATCC 8293 /NCDO 523)
          Length = 431

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 26/73 (35%), Positives = 42/73 (57%)
 Frame = +2

Query: 236 SPVRNWKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI 415
           +P    KT  F + +L +IDT+++  Q LILAP++ELA Q  +V    G+ + A   + I
Sbjct: 37  APTGTGKTLAFVLPVLSRIDTNLKRTQVLILAPSQELAMQTTQVAREWGNAVGASVASLI 96

Query: 416 GGTNVREDIRQLE 454
           GG N R    +++
Sbjct: 97  GGANGRRQADKIK 109


>UniRef50_A7U5W6 Cluster: DEAD-box helicase 1; n=8;
           Aconoidasida|Rep: DEAD-box helicase 1 - Plasmodium
           falciparum
          Length = 457

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 26/49 (53%), Positives = 30/49 (61%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +QQ  I   I G D++ QA+SG GK
Sbjct: 57  FKDFFLKPELLRAISESGFEHPSEVQQETIPAAITGTDILCQAKSGMGK 105


>UniRef50_UPI00015B4D43 Cluster: PREDICTED: hypothetical protein;
           n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical
           protein - Nasonia vitripennis
          Length = 990

 Score = 52.8 bits (121), Expect = 8e-06
 Identities = 29/67 (43%), Positives = 41/67 (61%), Gaps = 1/67 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNA-KCHACIGGTNV 430
           KTA F I  L+ ID  I   Q +ILAPTRE+A QI++V+ +LG  +   K  + IGG  +
Sbjct: 74  KTAVFGIIALEMIDIKISSVQVIILAPTREIAIQIKEVIASLGCEIKGLKVESFIGGVAM 133

Query: 431 REDIRQL 451
             D ++L
Sbjct: 134 DIDRKKL 140



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 23/50 (46%), Positives = 32/50 (64%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           TF  M L +++L G+   GF KPS IQ ++I     G D+I +A+SGTGK
Sbjct: 25  TFSQMGLSQQVLNGLLNCGFHKPSPIQHKSIPLGRCGFDLIVRAKSGTGK 74


>UniRef50_Q7MT81 Cluster: ATP-dependent RNA helicase, DEAD/DEAH box
           family; n=9; Bacteroidales|Rep: ATP-dependent RNA
           helicase, DEAD/DEAH box family - Porphyromonas
           gingivalis (Bacteroides gingivalis)
          Length = 427

 Score = 52.8 bits (121), Expect = 8e-06
 Identities = 24/49 (48%), Positives = 35/49 (71%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           FD++NL +E+L G+ A  F + + +Q   I P ++GRDVIA AQ+GTGK
Sbjct: 3   FDELNLGDEVLDGLDAMNFIETTPVQAATIPPILEGRDVIACAQTGTGK 51



 Score = 35.5 bits (78), Expect = 1.3
 Identities = 22/61 (36%), Positives = 32/61 (52%), Gaps = 3/61 (4%)
 Frame = +2

Query: 254 KTATFSISILQQIDT---SIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 424
           KTA + + IL ++     +     A+I+APTRELAQQI + V      +     A  GGT
Sbjct: 51  KTAAYLLPILDRLSAGEFASDVVNAVIMAPTRELAQQIDQQVEGFSYFMPVSAVAIYGGT 110

Query: 425 N 427
           +
Sbjct: 111 D 111


>UniRef50_Q28T45 Cluster: DEAD/DEAH box helicase-like protein; n=18;
           Alphaproteobacteria|Rep: DEAD/DEAH box helicase-like
           protein - Jannaschia sp. (strain CCS1)
          Length = 644

 Score = 52.8 bits (121), Expect = 8e-06
 Identities = 25/57 (43%), Positives = 36/57 (63%)
 Frame = +3

Query: 87  DWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           DW  +  TF D++L  ++ + I   G+E P+ IQ  AI P + GRDV+  AQ+GTGK
Sbjct: 6   DWTPMT-TFADLDLNPKVQKAIVEAGYESPTPIQAGAIPPALAGRDVLGIAQTGTGK 61



 Score = 33.5 bits (73), Expect = 5.4
 Identities = 21/70 (30%), Positives = 37/70 (52%), Gaps = 3/70 (4%)
 Frame = +2

Query: 254 KTATFS---ISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 424
           KTA+F+   I++L +     R  ++L+L PTRELA Q+ +       H+       IGG 
Sbjct: 61  KTASFTLPMITMLARGRARARMPRSLVLCPTRELAAQVAENFDIYAKHVKLTKALLIGGV 120

Query: 425 NVREDIRQLE 454
           + +E  + ++
Sbjct: 121 SFKEQEQAID 130


>UniRef50_A2TP65 Cluster: ATP-dependent RNA helicase, DEAD/DEAH box
           family protein; n=13; Bacteroidetes|Rep: ATP-dependent
           RNA helicase, DEAD/DEAH box family protein - Dokdonia
           donghaensis MED134
          Length = 638

 Score = 52.8 bits (121), Expect = 8e-06
 Identities = 27/67 (40%), Positives = 38/67 (56%), Gaps = 1/67 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F   +LQ ID S +  Q LI+APTREL  QI   +     H+   +  A  GG+N+
Sbjct: 52  KTAAFGFPLLQNIDASSKTTQGLIIAPTRELCLQITNEMKLYAKHIKGVRVVAVYGGSNI 111

Query: 431 REDIRQL 451
           +E  R++
Sbjct: 112 QEQAREI 118



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 25/51 (49%), Positives = 33/51 (64%), Gaps = 1/51 (1%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCI-QGRDVIAQAQSGTGK 257
           TFD + L   LL+ I   GFE PS IQ+ AI   + + RD++A AQ+GTGK
Sbjct: 2   TFDQLGLNAPLLQAIADMGFETPSKIQEEAIPQLLAEDRDMVALAQTGTGK 52


>UniRef50_Q2WF63 Cluster: Putative uncharacterized protein; n=4;
           Bilateria|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 561

 Score = 52.8 bits (121), Expect = 8e-06
 Identities = 28/66 (42%), Positives = 37/66 (56%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KT  F+I ILQ++        ALIL PTRELA QI +   ALG  +  KC   +GG ++ 
Sbjct: 139 KTLAFAIPILQKLSVDPYGIYALILTPTRELAFQIAEQFTALGKPITLKCSVIVGGRSLI 198

Query: 434 EDIRQL 451
              R+L
Sbjct: 199 HQAREL 204


>UniRef50_A2SQE1 Cluster: DEAD/DEAH box helicase domain protein;
           n=6; cellular organisms|Rep: DEAD/DEAH box helicase
           domain protein - Methanocorpusculum labreanum (strain
           ATCC 43576 / DSM 4855 / Z)
          Length = 656

 Score = 52.8 bits (121), Expect = 8e-06
 Identities = 25/51 (49%), Positives = 34/51 (66%)
 Frame = +3

Query: 105 ETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +TF +  + EELL+ I   GFE+P+ IQ  AI   + G+DV  QAQ+GTGK
Sbjct: 5   KTFAEFAISEELLQAIGDMGFEEPTPIQAMAIPQILDGKDVTGQAQTGTGK 55



 Score = 40.3 bits (90), Expect = 0.047
 Identities = 18/34 (52%), Positives = 25/34 (73%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQ 355
           KTA F I I++++D   +  QAL+L+PTRELA Q
Sbjct: 55  KTAAFGIPIIERLDPDNKNVQALVLSPTRELAIQ 88


>UniRef50_Q7UNV7 Cluster: ATP-dependent RNA helicase; n=2;
           Planctomycetaceae|Rep: ATP-dependent RNA helicase -
           Rhodopirellula baltica
          Length = 452

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 28/69 (40%), Positives = 40/69 (57%), Gaps = 2/69 (2%)
 Frame = +2

Query: 254 KTATFSISILQQIDT--SIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTN 427
           KTA FSI IL+Q+D+    R+ QA+++ PTRELA Q+      L   +  +     GG N
Sbjct: 94  KTAAFSIPILEQLDSLEDCRDPQAIVIVPTRELADQVAAEAERLARGVPTEIAVLSGGKN 153

Query: 428 VREDIRQLE 454
           +   +RQLE
Sbjct: 154 MNRQLRQLE 162



 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 21/52 (40%), Positives = 33/52 (63%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +++FD+++L   + R +   GF  PS IQ   I   + G+DVI QA++GTGK
Sbjct: 43  MDSFDELDLSPIMRRAVKDAGFTTPSPIQAALIPHALNGKDVIGQARTGTGK 94


>UniRef50_Q9S531 Cluster: DEAD-box protein; n=4;
           Cystobacterineae|Rep: DEAD-box protein - Myxococcus
           xanthus
          Length = 808

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 21/49 (42%), Positives = 33/49 (67%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           FDDMNL E +   +   G+  P+ +Q RA  P I+G+D+I ++++GTGK
Sbjct: 31  FDDMNLSEPIRLALAERGYTNPTPVQARAFRPAIEGKDLIVRSKTGTGK 79



 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 26/67 (38%), Positives = 37/67 (55%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTA F + +L++I    R  +ALIL PTRELA Q+   +  L  H   K  A  GG +++
Sbjct: 79  KTAAFGLPLLEKIPADERRVRALILCPTRELALQVADELKMLAKHKGLKIAAIYGGASMK 138

Query: 434 EDIRQLE 454
           +    LE
Sbjct: 139 QQEDALE 145


>UniRef50_Q1MY97 Cluster: DEAD/DEAH box helicase-like protein; n=2;
           Gammaproteobacteria|Rep: DEAD/DEAH box helicase-like
           protein - Oceanobacter sp. RED65
          Length = 614

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 27/68 (39%), Positives = 39/68 (57%), Gaps = 1/68 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDH-LNAKCHACIGGTNV 430
           KTA F++ +L +    +RE Q L+LAPTRELAQQ+   V +   H  N K  +  GG++ 
Sbjct: 56  KTAAFTLPLLARTQNEVREPQVLVLAPTRELAQQVAMAVESYSKHESNVKVASIYGGSDF 115

Query: 431 REDIRQLE 454
               R L+
Sbjct: 116 GSQFRALK 123



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 22/49 (44%), Positives = 33/49 (67%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F  + L   LLR I   G+E+PS IQ+++I   ++G+DV+  AQ+GTGK
Sbjct: 8   FASLGLPFNLLRAIEEQGYEQPSPIQEQSIPHLLEGKDVLGLAQTGTGK 56


>UniRef50_Q188H5 Cluster: Putative ATP-dependent RNA helicase; n=2;
           Clostridium difficile|Rep: Putative ATP-dependent RNA
           helicase - Clostridium difficile (strain 630)
          Length = 381

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 29/69 (42%), Positives = 42/69 (60%), Gaps = 2/69 (2%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQI--QKVVIALGDHLNAKCHACIGGTN 427
           KT  + + I ++IDTS RE QALILAPT EL  QI  Q  ++A    L+    A IG  N
Sbjct: 52  KTLAYLLPIFEKIDTSKRETQALILAPTHELVMQITNQVELLAKNAELSVTSLALIGEVN 111

Query: 428 VREDIRQLE 454
           +++ I+ ++
Sbjct: 112 IQKQIKNIK 120



 Score = 40.7 bits (91), Expect = 0.036
 Identities = 18/63 (28%), Positives = 32/63 (50%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSLYRF 281
           + TF+ + +   L+ G+       P+ +Q   I   IQ +D++  +Q+GTGK L  L   
Sbjct: 1   MNTFEQLKISSTLIDGLKKQDITSPTEVQSLVIGNIIQNKDLLINSQTGTGKTLAYLLPI 60

Query: 282 YNK 290
           + K
Sbjct: 61  FEK 63


>UniRef50_A7HDE9 Cluster: DEAD/DEAH box helicase domain protein;
           n=1; Anaeromyxobacter sp. Fw109-5|Rep: DEAD/DEAH box
           helicase domain protein - Anaeromyxobacter sp. Fw109-5
          Length = 680

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 27/67 (40%), Positives = 40/67 (59%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTA F+I IL++I    R   AL++ PTRELA Q+ +   AL  H +    A  GG ++ 
Sbjct: 70  KTAAFAIPILERIADGRRRPSALVMCPTRELAIQVAQEFTALAKHRDLSVVAVYGGASMG 129

Query: 434 EDIRQLE 454
           E +++LE
Sbjct: 130 EQLQKLE 136



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 19/50 (38%), Positives = 33/50 (66%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +FD++ L E + R I  +G+E+P+ +Q     P   G+DVI ++++GTGK
Sbjct: 21  SFDELGLSEPVRRAIAEHGYERPTPVQVSTFRPVRDGKDVIVRSKTGTGK 70


>UniRef50_Q4Q2Z6 Cluster: ATP-dependent RNA helicase, putative; n=7;
           Trypanosomatidae|Rep: ATP-dependent RNA helicase,
           putative - Leishmania major
          Length = 803

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 25/59 (42%), Positives = 35/59 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSLYRFYN 287
           F   NL++ LL  I   GF  P+ IQ++AI P +QG DV+A A++G+GK    L    N
Sbjct: 24  FQSFNLEKPLLDAILKQGFSVPTPIQRKAIPPMLQGNDVVAMARTGSGKTAAFLIPMLN 82



 Score = 36.7 bits (81), Expect = 0.58
 Identities = 23/68 (33%), Positives = 36/68 (52%), Gaps = 2/68 (2%)
 Frame = +2

Query: 254 KTATFSISILQQIDT--SIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTN 427
           KTA F I +L  +     I   + L+L+PTREL+ QI +   AL   L+ +  A +GG +
Sbjct: 72  KTAAFLIPMLNTLKAHAKIVGIRGLVLSPTRELSLQILRNGFALNKFLDLRFAALVGGDS 131

Query: 428 VREDIRQL 451
           + +    L
Sbjct: 132 MDQQFELL 139


>UniRef50_Q81VG0 Cluster: DEAD-box ATP-dependent RNA helicase ydbR;
           n=16; cellular organisms|Rep: DEAD-box ATP-dependent RNA
           helicase ydbR - Bacillus anthracis
          Length = 528

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 23/67 (34%), Positives = 38/67 (56%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTA F + +L ++DT     Q +++APTRELA Q+ + +  +G H   +     GG ++ 
Sbjct: 52  KTAAFGLPLLDKVDTHKESVQGIVIAPTRELAIQVGEELYKIGKHKRVRILPIYGGQDIN 111

Query: 434 EDIRQLE 454
             IR L+
Sbjct: 112 RQIRALK 118



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 22/50 (44%), Positives = 34/50 (68%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           TF ++ L + LL+ + + GFE+ + IQ   I   +QG+D+I QAQ+GTGK
Sbjct: 3   TFRELGLSDSLLQSVESMGFEEATPIQAETIPHALQGKDIIGQAQTGTGK 52


>UniRef50_UPI0000585111 Cluster: PREDICTED: hypothetical protein;
           n=1; Strongylocentrotus purpuratus|Rep: PREDICTED:
           hypothetical protein - Strongylocentrotus purpuratus
          Length = 1117

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 29/68 (42%), Positives = 40/68 (58%), Gaps = 1/68 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNA-KCHACIGGTNV 430
           KT  FS+  L+ ID +    Q LILAPTRE+A QIQ  + A+G  +   + H  IGGT  
Sbjct: 16  KTCVFSVIALEGIDLTNPSTQVLILAPTREIAVQIQDTIRAIGCEMEGLRSHVFIGGTLF 75

Query: 431 REDIRQLE 454
             D ++L+
Sbjct: 76  GPDRQKLK 83


>UniRef50_Q484Q1 Cluster: RNA helicase DeaD; n=1; Colwellia
           psychrerythraea 34H|Rep: RNA helicase DeaD - Colwellia
           psychrerythraea (strain 34H / ATCC BAA-681)
           (Vibriopsychroerythus)
          Length = 611

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 27/68 (39%), Positives = 40/68 (58%), Gaps = 1/68 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALG-DHLNAKCHACIGGTNV 430
           KTA F +  L +IDTSI++ Q ++LAPTRELA Q+ + + + G D    +     GG + 
Sbjct: 65  KTAAFGLPALAKIDTSIKKPQLMVLAPTRELAMQVAEAIESFGKDMKGLRVATLYGGQSY 124

Query: 431 REDIRQLE 454
               +QLE
Sbjct: 125 GPQFQQLE 132



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 20/49 (40%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F  + L E LL  + + GF   + IQ   I P + G+DV+ +AQ+GTGK
Sbjct: 17  FASLGLPENLLSAVLSIGFTSATDIQALTIPPLLAGKDVLGEAQTGTGK 65


>UniRef50_A6Q8Y9 Cluster: ATP-dependent RNA helicase, DEAD-box
           family; n=6; Bacteria|Rep: ATP-dependent RNA helicase,
           DEAD-box family - Sulfurovum sp. (strain NBC37-1)
          Length = 492

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 23/49 (46%), Positives = 34/49 (69%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D NLK+ +   +   GF++PS +Q+ AI   ++G D+IAQAQ+GTGK
Sbjct: 3   FTDFNLKDTIQAAVAEAGFKEPSPVQKDAIPLVLEGHDMIAQAQTGTGK 51



 Score = 35.9 bits (79), Expect = 1.0
 Identities = 19/67 (28%), Positives = 31/67 (46%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTA F + I+  +       + L++ PTRELA Q+   +   G     K     GGT   
Sbjct: 51  KTAAFGLPIMSMMKAD-GSVEGLVIVPTRELAMQVSDELFRFGKLSGLKTATVYGGTAYG 109

Query: 434 EDIRQLE 454
           + I +++
Sbjct: 110 KQIERIK 116


>UniRef50_A6DL95 Cluster: Probable ATP-dependent RNA helicase; n=1;
           Lentisphaera araneosa HTCC2155|Rep: Probable
           ATP-dependent RNA helicase - Lentisphaera araneosa
           HTCC2155
          Length = 482

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 20/49 (40%), Positives = 35/49 (71%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D+ LK+ +L  IY  G++KP+ IQ +++   +QG+D + +A++GTGK
Sbjct: 7   FQDLGLKKTILSAIYTAGYKKPTPIQNKSLKIILQGQDALVRAKTGTGK 55



 Score = 41.1 bits (92), Expect = 0.027
 Identities = 24/57 (42%), Positives = 31/57 (54%), Gaps = 1/57 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGG 421
           KTA F+I  LQ +   ++  Q LIL P REL +QI +  I LG  L N +     GG
Sbjct: 55  KTAAFAIPALQHLRAEVQHPQVLILTPGRELCKQISQEFIKLGKGLENFRVAEVTGG 111


>UniRef50_P75172 Cluster: Probable ATP-dependent RNA helicase MG425
           homolog; n=4; Mycoplasma|Rep: Probable ATP-dependent RNA
           helicase MG425 homolog - Mycoplasma pneumoniae
          Length = 450

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 28/75 (37%), Positives = 42/75 (56%), Gaps = 2/75 (2%)
 Frame = +2

Query: 236 SPVRNWKTATFSISILQQI--DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHA 409
           SP    KTA F I +++ +    S    Q L++APTRELA+QI+   I    H + K  +
Sbjct: 47  SPTGTGKTAVFGIPVIETLLKKPSKGTTQTLVVAPTRELAEQIKTTFINFAKHTHLKVVS 106

Query: 410 CIGGTNVREDIRQLE 454
            IGG  + + ++QLE
Sbjct: 107 LIGGIPIWQQLKQLE 121



 Score = 33.5 bits (73), Expect = 5.4
 Identities = 15/50 (30%), Positives = 29/50 (58%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           TF+++ +   L+  +      +P+ IQQ AI   +Q +++I  + +GTGK
Sbjct: 4   TFNELGVSPALIATLKDNNINQPTTIQQLAIPQFLQHQNLIVHSPTGTGK 53


>UniRef50_UPI0000D55AB0 Cluster: PREDICTED: similar to Probable
           ATP-dependent RNA helicase DDX20 (DEAD box protein 20)
           (DEAD box protein DP 103) (Component of gems 3)
           (Gemin-3) (Regulator of steroidogenic factor 1)
           (ROSF-1); n=1; Tribolium castaneum|Rep: PREDICTED:
           similar to Probable ATP-dependent RNA helicase DDX20
           (DEAD box protein 20) (DEAD box protein DP 103)
           (Component of gems 3) (Gemin-3) (Regulator of
           steroidogenic factor 1) (ROSF-1) - Tribolium castaneum
          Length = 688

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 26/66 (39%), Positives = 42/66 (63%), Gaps = 1/66 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNA-KCHACIGGTNV 430
           KT  FS   L+ ++T+    Q LIL PTRE+A QI+ V+ ++G H+N  K  + IGG  +
Sbjct: 74  KTLVFSTIALETVNTAKDHLQVLILVPTREIAVQIEDVLRSVGCHVNGLKIESFIGGRPL 133

Query: 431 REDIRQ 448
            +D+++
Sbjct: 134 EDDLKK 139



 Score = 41.5 bits (93), Expect = 0.021
 Identities = 21/53 (39%), Positives = 35/53 (66%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLL 266
           +F  + L +++ +G+   GF+KPS IQ +AI     G D+I +++SGTGK L+
Sbjct: 25  SFASLLLPDDIKQGLSVSGFKKPSPIQFKAIPLGRCGFDLIVKSKSGTGKTLV 77


>UniRef50_A4C0F9 Cluster: ATP-dependent RNA helicase; n=6;
           Bacteroidetes|Rep: ATP-dependent RNA helicase -
           Polaribacter irgensii 23-P
          Length = 447

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 28/68 (41%), Positives = 41/68 (60%), Gaps = 1/68 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI-GGTNV 430
           KTA F + +LQ ID +    QA+ILAPTREL QQI   +I+  +H +    A + GG  +
Sbjct: 54  KTAAFGLPLLQLIDVNNDAIQAIILAPTRELGQQIAANLISFAEHTSQVSIATLCGGIPI 113

Query: 431 REDIRQLE 454
           +  I +L+
Sbjct: 114 KPQIERLK 121


>UniRef50_Q54VF1 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 685

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 20/50 (40%), Positives = 35/50 (70%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           TF+ M L   +LR +   GF+ PS +Q ++I   +QG+D++A+A++G+GK
Sbjct: 24  TFESMGLDNRILRALKKMGFQNPSLVQSKSIPLSLQGKDILAKARTGSGK 73



 Score = 33.9 bits (74), Expect = 4.1
 Identities = 16/41 (39%), Positives = 29/41 (70%), Gaps = 5/41 (12%)
 Frame = +2

Query: 254 KTATFSISILQQI-----DTSIRECQALILAPTRELAQQIQ 361
           KTA +SI I+Q++      ++I+  +A++L PTREL +Q++
Sbjct: 73  KTAAYSIPIIQKVLMAKEKSNIKGVKAVVLVPTRELCEQVK 113


>UniRef50_Q56XG6 Cluster: DEAD-box ATP-dependent RNA helicase 15;
           n=27; Eukaryota|Rep: DEAD-box ATP-dependent RNA helicase
           15 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 427

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 27/49 (55%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DVI QA+SG GK
Sbjct: 48  FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGK 96



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 25/61 (40%), Positives = 34/61 (55%), Gaps = 1/61 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F +S LQQI+ S  +  AL+L  TRELA QI    +    +L + K     GG N+
Sbjct: 96  KTAVFVLSTLQQIEPSPGQVSALVLCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNI 155

Query: 431 R 433
           +
Sbjct: 156 K 156


>UniRef50_Q8GY84 Cluster: DEAD-box ATP-dependent RNA helicase 10;
           n=34; Eukaryota|Rep: DEAD-box ATP-dependent RNA helicase
           10 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 456

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 22/55 (40%), Positives = 39/55 (70%)
 Frame = +3

Query: 93  DQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           ++VV+TF ++ ++EEL++     G++ PS IQ  A+   ++G+DVI  AQ+G+GK
Sbjct: 5   NEVVKTFAELGVREELVKACERLGWKNPSKIQAEALPFALEGKDVIGLAQTGSGK 59



 Score = 35.1 bits (77), Expect = 1.8
 Identities = 16/35 (45%), Positives = 23/35 (65%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 421
           A +L+PTRELA QI +   ALG  ++ +C   +GG
Sbjct: 92  ACVLSPTRELAIQIAEQFEALGADISLRCAVLVGG 126


>UniRef50_Q0UZ59 Cluster: ATP-dependent RNA helicase DBP9; n=1;
           Phaeosphaeria nodorum|Rep: ATP-dependent RNA helicase
           DBP9 - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 597

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 23/54 (42%), Positives = 38/54 (70%)
 Frame = +3

Query: 96  QVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +VV +F ++ L+  LLRGI    +  P+A+Q +AI   +QGRD++A++ +GTGK
Sbjct: 44  EVVASFAELQLEPRLLRGIRDQKWGSPTAVQSKAIPLALQGRDILARSGTGTGK 97



 Score = 33.1 bits (72), Expect = 7.2
 Identities = 21/46 (45%), Positives = 29/46 (63%), Gaps = 1/46 (2%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQ-ALILAPTRELAQQIQKVVIALGDH 388
           KT  + + IL   +T +R+ + +LIL PT+ELA QI KV  AL  H
Sbjct: 97  KTGAYLLPILH--NTLLRKGKTSLILVPTKELALQITKVAKALSAH 140


>UniRef50_Q8R4Z5 Cluster: DEAD-box corepressor DP103 beta; n=5;
           Tetrapoda|Rep: DEAD-box corepressor DP103 beta - Mus
           musculus (Mouse)
          Length = 505

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 28/68 (41%), Positives = 38/68 (55%), Gaps = 1/68 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNA-KCHACIGGTNV 430
           KT  FS   L  +       Q LILAPTRE+A QI  V+ A+G  +   +CH  IGGT +
Sbjct: 113 KTCVFSTIALDSLILENYSTQILILAPTREIAVQIHSVITAIGIKMEGLECHVFIGGTPL 172

Query: 431 REDIRQLE 454
            +D  +L+
Sbjct: 173 SQDKTRLK 180



 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 23/49 (46%), Positives = 32/49 (65%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F+ + L   +L G+ A GFE+PS +Q +AI     G D+I QA+SGTGK
Sbjct: 65  FESLLLSRPVLEGLRAAGFERPSPVQLKAIPLGRCGLDLIVQAKSGTGK 113


>UniRef50_Q5GZA1 Cluster: ATP-dependent RNA helicase; n=6;
           Xanthomonas|Rep: ATP-dependent RNA helicase -
           Xanthomonas oryzae pv. oryzae
          Length = 482

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 27/74 (36%), Positives = 41/74 (55%), Gaps = 1/74 (1%)
 Frame = +2

Query: 236 SPVRNWKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHAC 412
           +P  + KTA F + +LQ++D ++   QAL+L PTRELA Q+ K +  L   + N K    
Sbjct: 70  APTGSGKTAAFGLGLLQKLDPALTRAQALVLCPTRELADQVGKQLRKLATGIPNMKLVVL 129

Query: 413 IGGTNVREDIRQLE 454
            GG  +   +  LE
Sbjct: 130 TGGMPLGPQLASLE 143



 Score = 39.1 bits (87), Expect = 0.11
 Identities = 19/49 (38%), Positives = 30/49 (61%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F  + L   L  GI A G+   + +Q +++ P ++G DVIAQA +G+GK
Sbjct: 28  FSALPLSPALAPGIDALGYTVLTPVQAQSLPPILRGLDVIAQAPTGSGK 76


>UniRef50_Q185X0 Cluster: ATP-dependent RNA helicase; n=3;
           Clostridium difficile|Rep: ATP-dependent RNA helicase -
           Clostridium difficile (strain 630)
          Length = 497

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 23/67 (34%), Positives = 40/67 (59%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTA+F+I + + I+      QALI+ PTRELA Q++  +  +G     +C A  G  +++
Sbjct: 53  KTASFAIPLCENINVDYNNIQALIVVPTRELALQVKDEISDIGRLKKVRCSAIFGKQSIK 112

Query: 434 EDIRQLE 454
           + I +L+
Sbjct: 113 DQIAELK 119


>UniRef50_A6TX49 Cluster: DEAD/DEAH box helicase domain protein;
           n=2; Firmicutes|Rep: DEAD/DEAH box helicase domain
           protein - Alkaliphilus metalliredigens QYMF
          Length = 387

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 27/73 (36%), Positives = 37/73 (50%)
 Frame = +2

Query: 236 SPVRNWKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI 415
           SP    KT  + I IL +ID   +  QA+ILAP+ ELA QI + +       N      I
Sbjct: 54  SPTGTGKTLAYLIPILHRIDPESKAVQAVILAPSHELAMQIHQTIEKWTKDNNISSEPLI 113

Query: 416 GGTNVREDIRQLE 454
           GG N++  I  L+
Sbjct: 114 GGANIKRQIENLK 126



 Score = 38.7 bits (86), Expect = 0.14
 Identities = 17/37 (45%), Positives = 26/37 (70%)
 Frame = +3

Query: 162 GFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           GF  P+ IQ+ AI   ++G+D+IA++ +GTGK L  L
Sbjct: 29  GFTAPTPIQEEAIPLILEGKDLIAESPTGTGKTLAYL 65


>UniRef50_A3J7I3 Cluster: ATP-independent RNA helicase; n=5;
           Bacteroidetes|Rep: ATP-independent RNA helicase -
           Flavobacteria bacterium BAL38
          Length = 463

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 25/72 (34%), Positives = 40/72 (55%)
 Frame = +2

Query: 236 SPVRNWKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI 415
           SP  + KT  F + I Q ++  ++  Q LIL P+REL  QI++V   +G H   K + C 
Sbjct: 40  SPTGSGKTLAFLLPIFQMMEEEVKGVQCLILVPSRELGLQIEQVWKKMGTHF--KVNTCY 97

Query: 416 GGTNVREDIRQL 451
           GG ++  + + L
Sbjct: 98  GGHSIETEFKNL 109


>UniRef50_Q9SEV5 Cluster: RNA helicase; n=1; Guillardia theta|Rep:
           RNA helicase - Guillardia theta (Cryptomonas phi)
          Length = 381

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 22/51 (43%), Positives = 35/51 (68%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           F D+ LK +LL G+   G+E PS IQ++ I   I  +D++A++++GTGK L
Sbjct: 17  FKDLKLKNDLLLGLNDLGYEHPSLIQEKIIPLAINNKDILARSKNGTGKTL 67



 Score = 36.3 bits (80), Expect = 0.77
 Identities = 19/46 (41%), Positives = 28/46 (60%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL 391
           KT +F I ILQ I +     +++IL PTRELA QI  ++  L  ++
Sbjct: 65  KTLSFLIPILQNIYSESYGIESIILVPTRELALQISSLLRKLSKYM 110


>UniRef50_P44586 Cluster: Cold-shock DEAD box protein A homolog;
           n=20; Pasteurellaceae|Rep: Cold-shock DEAD box protein A
           homolog - Haemophilus influenzae
          Length = 613

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 23/50 (46%), Positives = 32/50 (64%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           TF+D+ L E +L+ +   GFE PS IQQ  I   + G DV+  AQ+G+GK
Sbjct: 6   TFNDLGLPEFILKAVSDLGFETPSPIQQSCIPHLLNGNDVLGMAQTGSGK 55



 Score = 41.5 bits (93), Expect = 0.021
 Identities = 19/35 (54%), Positives = 26/35 (74%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQI 358
           KTA F++ +L QID S +  Q L++APTRELA Q+
Sbjct: 55  KTAAFALPLLAQIDPSEKHPQMLVMAPTRELAIQV 89


>UniRef50_Q9UHI6 Cluster: Probable ATP-dependent RNA helicase DDX20;
           n=24; Eumetazoa|Rep: Probable ATP-dependent RNA helicase
           DDX20 - Homo sapiens (Human)
          Length = 824

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 28/68 (41%), Positives = 38/68 (55%), Gaps = 1/68 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNA-KCHACIGGTNV 430
           KT  FS   L  +       Q LILAPTRE+A QI  V+ A+G  +   +CH  IGGT +
Sbjct: 112 KTCVFSTIALDSLVLENLSTQILILAPTREIAVQIHSVITAIGIKMEGLECHVFIGGTPL 171

Query: 431 REDIRQLE 454
            +D  +L+
Sbjct: 172 SQDKTRLK 179



 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 23/49 (46%), Positives = 32/49 (65%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F+ + L   +L G+ A GFE+PS +Q +AI     G D+I QA+SGTGK
Sbjct: 64  FESLLLSRPVLEGLRAAGFERPSPVQLKAIPLGRCGLDLIVQAKSGTGK 112


>UniRef50_Q0TQ86 Cluster: ATP-dependent RNA helicase, DEAD/DEAH box
           family; n=3; Clostridium perfringens|Rep: ATP-dependent
           RNA helicase, DEAD/DEAH box family - Clostridium
           perfringens (strain ATCC 13124 / NCTC 8237 / Type A)
          Length = 405

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 23/63 (36%), Positives = 40/63 (63%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSLYRF 281
           ++ F  + L EE+L+ +   G E+P+ IQ++AI   ++G++VI +A++GTGK L  L   
Sbjct: 1   MDKFLKLGLSEEVLKSLVGLGIEEPTDIQEKAIPEILKGKNVIGKAETGTGKTLAYLLPI 60

Query: 282 YNK 290
             K
Sbjct: 61  IEK 63


>UniRef50_A7CSF3 Cluster: DEAD/DEAH box helicase domain protein;
           n=1; Opitutaceae bacterium TAV2|Rep: DEAD/DEAH box
           helicase domain protein - Opitutaceae bacterium TAV2
          Length = 343

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 22/49 (44%), Positives = 32/49 (65%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F  + L   L+RG+ A G+  P+ +Q RAI   + GRD++A AQ+GTGK
Sbjct: 3   FSKLGLPSSLVRGVQAMGYVDPTPVQLRAIPVVLAGRDLVASAQTGTGK 51


>UniRef50_Q016I5 Cluster: Predicted ATP-dependent RNA helicase FAL1,
           involved in rRNA maturation, DEAD-box superfamily; n=2;
           Ostreococcus|Rep: Predicted ATP-dependent RNA helicase
           FAL1, involved in rRNA maturation, DEAD-box superfamily
           - Ostreococcus tauri
          Length = 1222

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 20/49 (40%), Positives = 34/49 (69%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F+ M +  E+ R +   G+  P+ IQ++AI P ++GRDV+A A++G+GK
Sbjct: 468 FESMEILPEVFRAVKRKGYRVPTPIQRKAIPPALEGRDVVAMARTGSGK 516


>UniRef50_A6PWH4 Cluster: HLA-B associated transcript 1; n=6; Homo
           sapiens|Rep: HLA-B associated transcript 1 - Homo
           sapiens (Human)
          Length = 197

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 47  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 95


>UniRef50_Q5L3G9 Cluster: DEAD-box ATP-dependent RNA helicase ydbR;
           n=7; Bacteria|Rep: DEAD-box ATP-dependent RNA helicase
           ydbR - Geobacillus kaustophilus
          Length = 467

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 22/50 (44%), Positives = 34/50 (68%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           TF ++ L +E+++ I   GFE+ + IQ + I   +Q +DVI QAQ+GTGK
Sbjct: 3   TFQELGLSQEVMKAIERMGFEETTPIQAKTIPLSLQNKDVIGQAQTGTGK 52



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 23/67 (34%), Positives = 38/67 (56%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTA F I I+++++      QAL++APTRELA Q+ + +  +G     +     GG ++ 
Sbjct: 52  KTAAFGIPIVEKVNVKNSAVQALVVAPTRELAIQVSEELYKIGAVKRVRVLPIYGGQDIE 111

Query: 434 EDIRQLE 454
             IR L+
Sbjct: 112 RQIRALK 118


>UniRef50_Q13838 Cluster: Spliceosome RNA helicase BAT1; n=55;
           Eukaryota|Rep: Spliceosome RNA helicase BAT1 - Homo
           sapiens (Human)
          Length = 428

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 47  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 95



 Score = 39.9 bits (89), Expect = 0.063
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG ++
Sbjct: 95  KTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSI 154

Query: 431 RED 439
           ++D
Sbjct: 155 KKD 157


>UniRef50_P0A9P8 Cluster: Cold-shock DEAD box protein A; n=54;
           Gammaproteobacteria|Rep: Cold-shock DEAD box protein A -
           Shigella flexneri
          Length = 629

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 23/50 (46%), Positives = 31/50 (62%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           TF D+ LK  +L  +   G+EKPS IQ   I   + GRDV+  AQ+G+GK
Sbjct: 7   TFADLGLKAPILEALNDLGYEKPSPIQAECIPHLLNGRDVLGMAQTGSGK 56



 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 25/67 (37%), Positives = 36/67 (53%), Gaps = 1/67 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA FS+ +LQ +D  ++  Q L+LAPTRELA Q+ + +     H+      A  GG   
Sbjct: 56  KTAAFSLPLLQNLDPELKAPQILVLAPTRELAVQVAEAMTDFSKHMRGVNVVALYGGQRY 115

Query: 431 REDIRQL 451
              +R L
Sbjct: 116 DVQLRAL 122


>UniRef50_O00148 Cluster: ATP-dependent RNA helicase DDX39; n=27;
           Eukaryota|Rep: ATP-dependent RNA helicase DDX39 - Homo
           sapiens (Human)
          Length = 427

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 46  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 94



 Score = 37.9 bits (84), Expect = 0.25
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F ++ LQQI+    +   L++  TRELA QI K       ++ + K     GG ++
Sbjct: 94  KTAVFVLATLQQIEPVNGQVTVLVMCHTRELAFQISKEYERFSKYMPSVKVSVFFGGLSI 153

Query: 431 RED 439
           ++D
Sbjct: 154 KKD 156


>UniRef50_Q3AFI3 Cluster: ATP-dependent RNA helicase, DEAD box
           family; n=1; Carboxydothermus hydrogenoformans
           Z-2901|Rep: ATP-dependent RNA helicase, DEAD box family
           - Carboxydothermus hydrogenoformans (strain Z-2901 / DSM
           6008)
          Length = 430

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 27/72 (37%), Positives = 39/72 (54%)
 Frame = +2

Query: 236 SPVRNWKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI 415
           +P    KTA + + +LQ+I    ++ Q LI+ PTRELA Q+   V  LG +L  +  A  
Sbjct: 46  APTGTGKTAAYLLPVLQRIQRG-KKAQVLIVTPTRELALQVADEVAKLGKYLKVRALAVY 104

Query: 416 GGTNVREDIRQL 451
           GG  +   IR L
Sbjct: 105 GGQAIERQIRGL 116



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 20/52 (38%), Positives = 32/52 (61%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +E F  + L   LL+ +   GFE P+ IQ+ AI   ++G +++ QA +GTGK
Sbjct: 1   MEEFKKLGLITPLLKAVNDLGFEMPTPIQKEAIPLILEGHNLVGQAPTGTGK 52


>UniRef50_Q1QYG3 Cluster: DEAD/DEAH box helicase-like protein; n=1;
           Chromohalobacter salexigens DSM 3043|Rep: DEAD/DEAH box
           helicase-like protein - Chromohalobacter salexigens
           (strain DSM 3043 / ATCC BAA-138 / NCIMB13768)
          Length = 568

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 22/50 (44%), Positives = 33/50 (66%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           TF +++L   +L  +   G+E PS IQ + I   ++GRDV+ QAQ+GTGK
Sbjct: 10  TFAELSLPSTILSTLETLGYETPSLIQAKTIPALLEGRDVLGQAQTGTGK 59



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 26/67 (38%), Positives = 38/67 (56%), Gaps = 1/67 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNA-KCHACIGGTNV 430
           KTA F++ +L ++D   RE Q L+LAPTRELAQQ+    +  G  +   +  +  GG   
Sbjct: 59  KTAAFALPLLSRLDLQRREPQVLVLAPTRELAQQVAASFVQYGRGVKGLEVLSLCGGQEY 118

Query: 431 REDIRQL 451
           RE +  L
Sbjct: 119 REQLSGL 125


>UniRef50_A7BCL2 Cluster: Putative uncharacterized protein; n=1;
           Actinomyces odontolyticus ATCC 17982|Rep: Putative
           uncharacterized protein - Actinomyces odontolyticus ATCC
           17982
          Length = 722

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 28/69 (40%), Positives = 38/69 (55%)
 Frame = +3

Query: 51  DLREWTLGHLHTDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVI 230
           D RE+   H   + D    TF  + L EE+L  +   GF  P+ IQ  AI P ++ RDV+
Sbjct: 28  DAREFGDDHADEE-DTDTVTFASLGLPEEILAAVTDMGFRVPTPIQAAAIPPLLELRDVV 86

Query: 231 AQAQSGTGK 257
             AQ+GTGK
Sbjct: 87  GIAQTGTGK 95



 Score = 41.5 bits (93), Expect = 0.021
 Identities = 19/39 (48%), Positives = 25/39 (64%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVV 370
           KTA F + +L  +D   R  QAL+LAPTRELA Q  + +
Sbjct: 95  KTAAFGLPLLAIVDADERNVQALVLAPTRELAMQSAQAI 133


>UniRef50_A4J5M3 Cluster: DEAD/DEAH box helicase domain protein;
           n=2; Clostridiales|Rep: DEAD/DEAH box helicase domain
           protein - Desulfotomaculum reducens MI-1
          Length = 438

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 29/69 (42%), Positives = 38/69 (55%), Gaps = 2/69 (2%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDH--LNAKCHACIGGTN 427
           KT  + + I Q+ID+S RE QALILAPT EL  QI K +  L  +  L       IG  N
Sbjct: 53  KTLAYLLPIFQKIDSSKRETQALILAPTHELVMQIDKQIKTLSSNAGLTINSTVMIGEVN 112

Query: 428 VREDIRQLE 454
           +   I +L+
Sbjct: 113 IVRQIEKLK 121



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 21/64 (32%), Positives = 39/64 (60%)
 Frame = +3

Query: 99  VVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSLYR 278
           +V +FD + +  ++  G+   G + P+AIQ+ AI   ++ +D+I Q+Q+G+GK L  L  
Sbjct: 1   MVTSFDKLEIDADIAEGLSKQGIKNPTAIQKVAIPLALKNKDIIGQSQTGSGKTLAYLLP 60

Query: 279 FYNK 290
            + K
Sbjct: 61  IFQK 64


>UniRef50_A4EAF2 Cluster: Putative uncharacterized protein; n=1;
           Collinsella aerofaciens ATCC 25986|Rep: Putative
           uncharacterized protein - Collinsella aerofaciens ATCC
           25986
          Length = 749

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 21/49 (42%), Positives = 34/49 (69%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           FD++ L +E+LR I   G+  P+ +Q  +I   ++GRD++A AQ+GTGK
Sbjct: 48  FDELGLSDEMLRAIENLGYTAPTPVQAGSIPVVLEGRDLLAAAQTGTGK 96


>UniRef50_Q0W8H7 Cluster: ATP-dependent RNA helicase; n=1;
           uncultured methanogenic archaeon RC-I|Rep: ATP-dependent
           RNA helicase - Uncultured methanogenic archaeon RC-I
          Length = 497

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 20/49 (40%), Positives = 36/49 (73%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F ++NL   ++R ++  GFE+ + IQ++AI   ++G+D+I QA++GTGK
Sbjct: 4   FTELNLTPSIVRAVHEMGFEEATPIQEQAIPLAMEGKDLIGQARTGTGK 52



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 22/67 (32%), Positives = 37/67 (55%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTA F I +++ I  + +  Q L++ PTRELA Q+ + +  +G     +  A  GG + R
Sbjct: 52  KTAAFGIPMVEAIRPTSKGVQGLVVVPTRELAVQVAEELTRIGKVRGIRSVAIYGGQDFR 111

Query: 434 EDIRQLE 454
             ++ LE
Sbjct: 112 SQVKALE 118


>UniRef50_P0C218 Cluster: Probable ATP-dependent RNA helicase DDX20;
           n=9; Euteleostomi|Rep: Probable ATP-dependent RNA
           helicase DDX20 - Danio rerio (Zebrafish) (Brachydanio
           rerio)
          Length = 761

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 26/68 (38%), Positives = 38/68 (55%), Gaps = 1/68 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNA-KCHACIGGTNV 430
           KT  F+   L  +       Q L+LAPTRE+A QI  VV+A+G  +   +CH  IGG  +
Sbjct: 76  KTCVFTTIALDSLILENATTQVLVLAPTREIAVQIHAVVMAIGSAMEGLECHVFIGGRPI 135

Query: 431 REDIRQLE 454
            +D + L+
Sbjct: 136 SQDKQHLK 143



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 23/49 (46%), Positives = 32/49 (65%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F  + L + +L G+ A GF++PS IQ +AI     G D+I QA+SGTGK
Sbjct: 28  FSSLLLSKPVLEGLSASGFQRPSPIQLKAIPLGRCGLDLIVQAKSGTGK 76


>UniRef50_UPI00015B5D7B Cluster: PREDICTED: similar to LD28101p;
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           LD28101p - Nasonia vitripennis
          Length = 782

 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 22/60 (36%), Positives = 36/60 (60%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSLYRFYNK 290
           F  M L + ++RGI   G++ P+ IQ++ I   + GRDV+A A++G+GK    L   + K
Sbjct: 40  FQSMGLSQSVIRGILKRGYKIPTPIQRKTIPIALDGRDVVAMARTGSGKTACFLIPMFEK 99



 Score = 39.5 bits (88), Expect = 0.083
 Identities = 22/61 (36%), Positives = 35/61 (57%), Gaps = 2/61 (3%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRE--CQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTN 427
           KTA F I + +++ T   +   +ALIL+PTRELA Q Q+ +  +G     K    +GG +
Sbjct: 88  KTACFLIPMFEKLKTRQAKTGARALILSPTRELALQTQRFIKEIGRFTGLKSSVILGGDS 147

Query: 428 V 430
           +
Sbjct: 148 M 148


>UniRef50_Q62IF8 Cluster: ATP-dependent RNA helicase RhlE; n=59;
           Betaproteobacteria|Rep: ATP-dependent RNA helicase RhlE
           - Burkholderia mallei (Pseudomonas mallei)
          Length = 482

 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 23/50 (46%), Positives = 31/50 (62%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           TFD   L  E+L+ I   G+  P+ IQ +AI   + GRDV+  AQ+GTGK
Sbjct: 12  TFDQFGLAAEILKAIAEQGYTTPTPIQAKAIPVVLSGRDVMGAAQTGTGK 61



 Score = 39.5 bits (88), Expect = 0.083
 Identities = 27/74 (36%), Positives = 38/74 (51%), Gaps = 8/74 (10%)
 Frame = +2

Query: 254 KTATFSISILQ----QIDTSIRECQ----ALILAPTRELAQQIQKVVIALGDHLNAKCHA 409
           KTA+FS+ I+Q    Q +TS    +    ALIL PTRELA Q+   V A   H   +   
Sbjct: 61  KTASFSLPIIQRLLPQANTSASPARHPVRALILTPTRELADQVAANVHAYAKHTPLRSAV 120

Query: 410 CIGGTNVREDIRQL 451
             GG ++   + +L
Sbjct: 121 VFGGVDMNPQMAEL 134


>UniRef50_Q0AVQ9 Cluster: ATP-dependent RNA helicase; n=1;
           Syntrophomonas wolfei subsp. wolfei str. Goettingen|Rep:
           ATP-dependent RNA helicase - Syntrophomonas wolfei
           subsp. wolfei (strain Goettingen)
          Length = 530

 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 25/51 (49%), Positives = 34/51 (66%)
 Frame = +3

Query: 105 ETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           E F  M LK +LL+ I   GFEKP+ IQ ++I   + G D++ QAQ+GTGK
Sbjct: 4   ENFYSMGLKTDLLQMIDEKGFEKPTPIQVKSIPIAMAGLDLMGQAQTGTGK 54



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 24/66 (36%), Positives = 37/66 (56%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTA+F I IL ++       QAL+L PTRELA Q+ + + +L   +  +  A  GG ++ 
Sbjct: 54  KTASFGIPILNRVIKG-EGLQALVLCPTRELAVQVTEEISSLSRRMRIQVLAIYGGQSIE 112

Query: 434 EDIRQL 451
             +R L
Sbjct: 113 LQLRSL 118


>UniRef50_A6T3R2 Cluster: ATP-dependent RNA helicase; n=52; cellular
           organisms|Rep: ATP-dependent RNA helicase -
           Janthinobacterium sp. (strain Marseille) (Minibacterium
           massiliensis)
          Length = 778

 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 24/49 (48%), Positives = 30/49 (61%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D+ L E LLR +   G+E PS IQ   I   +  RDV+ QAQ+GTGK
Sbjct: 9   FADLKLSEPLLRVLQELGYESPSPIQAATIPLLLNNRDVLGQAQTGTGK 57



 Score = 40.7 bits (91), Expect = 0.036
 Identities = 20/35 (57%), Positives = 26/35 (74%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQI 358
           KTA+F++ IL +ID      QAL+LAPTRELA Q+
Sbjct: 57  KTASFALPILARIDIKQTTPQALVLAPTRELAIQV 91


>UniRef50_Q54TJ4 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 783

 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 19/55 (34%), Positives = 37/55 (67%)
 Frame = +3

Query: 93  DQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           ++ + TF++++L   LL+ +   GF +P+ IQ +AI   + G+D++A A +G+GK
Sbjct: 186 EEELPTFEELHLSRPLLKAVQKLGFSQPTPIQAKAIPLALNGKDILASASTGSGK 240



 Score = 39.9 bits (89), Expect = 0.063
 Identities = 24/66 (36%), Positives = 35/66 (53%), Gaps = 3/66 (4%)
 Frame = +2

Query: 233 SSPVRNWKTATFSISILQQI---DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKC 403
           S+   + KTA F + +L+++   D+  R  + LIL PTRELA Q Q V+  L    N   
Sbjct: 233 SASTGSGKTAAFLLPVLERLLFRDSEYRAIRVLILLPTRELALQCQSVMENLAQFSNITS 292

Query: 404 HACIGG 421
              +GG
Sbjct: 293 CLIVGG 298


>UniRef50_Q6CHU3 Cluster: Similarities with sp|P38112 Saccharomyces
           cerevisiae ATP-dependent RNA helicase MAK5; n=1;
           Yarrowia lipolytica|Rep: Similarities with sp|P38112
           Saccharomyces cerevisiae ATP-dependent RNA helicase MAK5
           - Yarrowia lipolytica (Candida lipolytica)
          Length = 998

 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 21/52 (40%), Positives = 35/52 (67%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           T +   L   L++G+YA G++ P+ IQ+++I P + G DVI +A +G+GK L
Sbjct: 358 TLNGEQLNYSLIQGLYALGYKSPTEIQKKSIPPILAGDDVIGKASTGSGKTL 409



 Score = 33.5 bits (73), Expect = 5.4
 Identities = 21/46 (45%), Positives = 26/46 (56%), Gaps = 1/46 (2%)
 Frame = +2

Query: 296 TSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHAC-IGGTNV 430
           +S++  QA++ APTRELA QI        DHLNA    C I G  V
Sbjct: 515 SSVKPPQAIVFAPTRELAHQIT-------DHLNAVSQFCPISGPRV 553


>UniRef50_O26305 Cluster: ATP-dependent RNA helicase, eIF-4A family;
           n=1; Methanothermobacter thermautotrophicus str. Delta
           H|Rep: ATP-dependent RNA helicase, eIF-4A family -
           Methanobacterium thermoautotrophicum
          Length = 425

 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 25/66 (37%), Positives = 39/66 (59%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTA F+I +L+ ++   R  QALI+ PTREL  Q+ + +  +G ++  K  A  GG ++ 
Sbjct: 54  KTAAFAIPVLENLEAE-RVPQALIICPTRELCLQVSEEIKRIGKYMKVKVLAVYGGQSIG 112

Query: 434 EDIRQL 451
             I QL
Sbjct: 113 NQIAQL 118



 Score = 37.9 bits (84), Expect = 0.25
 Identities = 16/49 (32%), Positives = 28/49 (57%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F + ++  ++ R +   GFE  + IQ   +   + G DV+ +AQ+GTGK
Sbjct: 6   FSEFDISGDINRALDDMGFESTTPIQALTLPVTLDGMDVVGEAQTGTGK 54


>UniRef50_P96614 Cluster: DEAD-box ATP-dependent RNA helicase ydbR;
           n=90; Bacilli|Rep: DEAD-box ATP-dependent RNA helicase
           ydbR - Bacillus subtilis
          Length = 494

 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 23/50 (46%), Positives = 32/50 (64%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           TF D NL  +L++ I   GFE+ + IQ + I   +  +DVI QAQ+GTGK
Sbjct: 4   TFQDFNLSSDLMKAINRMGFEEATPIQAQTIPLGLSNKDVIGQAQTGTGK 53



 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 24/67 (35%), Positives = 39/67 (58%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTA F I ++++I+      QA+++APTRELA Q+ + +  +G    AK     GG ++ 
Sbjct: 53  KTAAFGIPLVEKINPESPNIQAIVIAPTRELAIQVSEELYKIGQDKRAKVLPIYGGQDIG 112

Query: 434 EDIRQLE 454
             IR L+
Sbjct: 113 RQIRALK 119


>UniRef50_Q09719 Cluster: ATP-dependent RNA helicase dbp10; n=2;
           Schizosaccharomyces pombe|Rep: ATP-dependent RNA
           helicase dbp10 - Schizosaccharomyces pombe (Fission
           yeast)
          Length = 848

 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 21/49 (42%), Positives = 33/49 (67%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F  M L + LLR I+  GF+ P+ IQ++ I   ++GRDV+  A++G+GK
Sbjct: 71  FQSMGLNQTLLRAIFKKGFKAPTPIQRKTIPLLLEGRDVVGMARTGSGK 119



 Score = 39.1 bits (87), Expect = 0.11
 Identities = 23/68 (33%), Positives = 37/68 (54%), Gaps = 2/68 (2%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIREC--QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTN 427
           KTA F I +++ + +++     +ALIL+P RELA Q  KVV       + +  A +GG +
Sbjct: 119 KTAAFVIPMIEHLKSTLANSNTRALILSPNRELALQTVKVVKDFSKGTDLRSVAIVGGVS 178

Query: 428 VREDIRQL 451
           + E    L
Sbjct: 179 LEEQFSLL 186


>UniRef50_Q9KNA4 Cluster: ATP-dependent RNA helicase, DEAD box
           family; n=48; Gammaproteobacteria|Rep: ATP-dependent RNA
           helicase, DEAD box family - Vibrio cholerae
          Length = 452

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 23/63 (36%), Positives = 40/63 (63%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSLYRFYNK 290
           F D+ L   LL+ +  Y F++ + IQQ+AI   I GRD++A +++G+GK L  +    +K
Sbjct: 7   FKDLGLDNRLLKNLAHYNFKQATEIQQQAIPLTIAGRDLLASSKTGSGKTLAFVLPMLHK 66

Query: 291 SIQ 299
           S++
Sbjct: 67  SLK 69



 Score = 33.1 bits (72), Expect = 7.2
 Identities = 23/77 (29%), Positives = 40/77 (51%), Gaps = 4/77 (5%)
 Frame = +2

Query: 233 SSPVRNWKTATFSISILQQ-IDT---SIRECQALILAPTRELAQQIQKVVIALGDHLNAK 400
           SS   + KT  F + +L + + T   S ++ + LIL PTRELA+Q+   + ++   L+  
Sbjct: 48  SSKTGSGKTLAFVLPMLHKSLKTKAFSAKDPRGLILVPTRELAKQVYGELRSMLGGLSYT 107

Query: 401 CHACIGGTNVREDIRQL 451
                GG N  + ++ L
Sbjct: 108 ATLITGGENFNDQVKAL 124


>UniRef50_Q8EZ11 Cluster: ATP-dependent RNA helicase; n=4;
           Leptospira|Rep: ATP-dependent RNA helicase - Leptospira
           interrogans
          Length = 521

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 22/49 (44%), Positives = 31/49 (63%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F ++NL  E+   I   GFE+ S IQ  AI   ++G+D+I  AQ+GTGK
Sbjct: 11  FSELNLSAEIQNAILEMGFEEASPIQSEAIPVILKGKDIIGHAQTGTGK 59



 Score = 37.9 bits (84), Expect = 0.25
 Identities = 22/67 (32%), Positives = 34/67 (50%), Gaps = 1/67 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F+I  ++ ++   +  QALIL PTREL  Q+ +    L  +  N +     GG  +
Sbjct: 59  KTAAFAIPTIELLEVESKHLQALILCPTRELVIQVSEQFRKLIKYKGNFEVVPIYGGQEI 118

Query: 431 REDIRQL 451
              +R L
Sbjct: 119 ERQLRAL 125


>UniRef50_Q8D7D0 Cluster: Superfamily II DNA and RNA helicase; n=20;
           Gammaproteobacteria|Rep: Superfamily II DNA and RNA
           helicase - Vibrio vulnificus
          Length = 418

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 24/53 (45%), Positives = 33/53 (62%)
 Frame = +3

Query: 99  VVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +  TF ++ L   L   +   GF  P+ IQQ+AI   +QGRDV+A AQ+GTGK
Sbjct: 1   MTNTFIELGLDSSLSDHLSQLGFNTPTPIQQQAIPHLLQGRDVLAAAQTGTGK 53



 Score = 41.9 bits (94), Expect = 0.016
 Identities = 26/72 (36%), Positives = 36/72 (50%), Gaps = 6/72 (8%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRE------CQALILAPTRELAQQIQKVVIALGDHLNAKCHACI 415
           KTA + + ++Q +    RE       +ALILAPTRELAQQ+   +     H         
Sbjct: 53  KTAAYGLPLIQMLSRQSREETAPKHPRALILAPTRELAQQVFDNLKQYAQHTELAIVTVY 112

Query: 416 GGTNVREDIRQL 451
           GGT++R    QL
Sbjct: 113 GGTSIRVQQEQL 124


>UniRef50_Q5FUQ9 Cluster: ATP-dependent RNA helicase; n=11; cellular
           organisms|Rep: ATP-dependent RNA helicase -
           Gluconobacter oxydans (Gluconobacter suboxydans)
          Length = 793

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 22/49 (44%), Positives = 32/49 (65%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D+ L E ++R I   G+E P+ IQ +AI   ++G DV+  AQ+GTGK
Sbjct: 293 FADLGLSEPIMRAIEELGYEHPTPIQAQAIPEVLKGHDVLGVAQTGTGK 341



 Score = 37.5 bits (83), Expect = 0.33
 Identities = 24/64 (37%), Positives = 37/64 (57%), Gaps = 3/64 (4%)
 Frame = +2

Query: 254 KTATFSISILQQIDTS---IRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 424
           KTA+F++ +LQ++  S    R  ++LIL PTRELA Q+ +     G +L       IGG 
Sbjct: 341 KTASFTLPMLQKLAGSRARARMPRSLILEPTRELALQVAENFKLYGKYLRLTHALLIGGE 400

Query: 425 NVRE 436
           ++ E
Sbjct: 401 SMAE 404


>UniRef50_A6QHA1 Cluster: ATP-dependent RNA helicase DEAD/DEAH box
           family protein; n=16; Staphylococcus|Rep: ATP-dependent
           RNA helicase DEAD/DEAH box family protein -
           Staphylococcus aureus (strain Newman)
          Length = 448

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 27/76 (35%), Positives = 40/76 (52%), Gaps = 1/76 (1%)
 Frame = +2

Query: 215 RTRCYRSSPVRNWKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGD-HL 391
           RT     S     K+  F + ++Q ID+ I+E QA+++APTRELAQQ+      L     
Sbjct: 41  RTNLIGQSQTGTGKSHAFLLPLMQLIDSEIKEPQAIVVAPTRELAQQLYDAANHLSQFKA 100

Query: 392 NAKCHACIGGTNVRED 439
                  IGGT++ +D
Sbjct: 101 GVSVKVFIGGTDIEKD 116



 Score = 43.2 bits (97), Expect = 0.007
 Identities = 23/66 (34%), Positives = 37/66 (56%), Gaps = 3/66 (4%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK---LLLSLYRF 281
           F+  NL+  L+  +    FEKP+ IQ R I   ++  ++I Q+Q+GTGK    LL L + 
Sbjct: 6   FEQFNLESSLIDAVKDLNFEKPTEIQNRIIPRILKRTNLIGQSQTGTGKSHAFLLPLMQL 65

Query: 282 YNKSIQ 299
            +  I+
Sbjct: 66  IDSEIK 71


>UniRef50_A3WD13 Cluster: DNA and RNA helicase; n=2;
           Alphaproteobacteria|Rep: DNA and RNA helicase -
           Erythrobacter sp. NAP1
          Length = 484

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 20/49 (40%), Positives = 34/49 (69%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D+ L + +L+ +   G+  P+ IQ++AI P ++GRD++  AQ+GTGK
Sbjct: 4   FSDLGLSQPVLQALDLKGYSTPTPIQEQAIPPVLEGRDLLGIAQTGTGK 52



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 28/71 (39%), Positives = 38/71 (53%), Gaps = 5/71 (7%)
 Frame = +2

Query: 254 KTATF---SISILQQIDTSI--RECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIG 418
           KTA F   SI  L++ D  I  + C+ L+LAPTREL  QI       G     K  + +G
Sbjct: 52  KTAAFMLPSIDRLREADNRIPFKSCRMLVLAPTRELVSQIAASAKDYGALAGLKVQSIVG 111

Query: 419 GTNVREDIRQL 451
           GT+V +D  +L
Sbjct: 112 GTSVNKDRNKL 122


>UniRef50_Q8SY39 Cluster: LD28101p; n=3; Diptera|Rep: LD28101p -
           Drosophila melanogaster (Fruit fly)
          Length = 827

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 23/60 (38%), Positives = 37/60 (61%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSLYRFYNK 290
           F  M L  EL++GI   G++ P+ IQ++ I   ++GRDV+A A++G+GK    L   + K
Sbjct: 41  FQSMGLGFELIKGITKRGYKVPTPIQRKTIPLILEGRDVVAMAKTGSGKTACFLIPLFEK 100



 Score = 38.3 bits (85), Expect = 0.19
 Identities = 22/61 (36%), Positives = 34/61 (55%), Gaps = 2/61 (3%)
 Frame = +2

Query: 254 KTATFSISILQQIDTS--IRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTN 427
           KTA F I + +++      +  +ALIL+PTRELA Q  K +  LG  +  K    +GG +
Sbjct: 89  KTACFLIPLFEKLQRREPTKGARALILSPTRELAVQTYKFIKELGRFMELKSILVLGGDS 148

Query: 428 V 430
           +
Sbjct: 149 M 149


>UniRef50_Q54Y81 Cluster: Putative RNA helicase; n=2; Dictyostelium
           discoideum|Rep: Putative RNA helicase - Dictyostelium
           discoideum AX4
          Length = 834

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 21/52 (40%), Positives = 34/52 (65%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           + T+ + NL  E+L  I   G+EKPS IQ ++I   + GRD++  A++G+GK
Sbjct: 412 IRTWQESNLPREILEAIRQLGYEKPSPIQMQSIPISLTGRDILGIAETGSGK 463



 Score = 38.7 bits (86), Expect = 0.14
 Identities = 18/53 (33%), Positives = 28/53 (52%)
 Frame = +2

Query: 293 DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQL 451
           DT      AL++APTREL QQI+K       H   +  + +GG ++ +   Q+
Sbjct: 484 DTEADGPYALVMAPTRELVQQIEKETRNFAQHFGFRVVSLVGGQSIEDQAYQV 536


>UniRef50_Q4QC38 Cluster: RNA helicase, putative; n=7;
           Trypanosomatidae|Rep: RNA helicase, putative -
           Leishmania major
          Length = 435

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 23/55 (41%), Positives = 33/55 (60%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSLY 275
           F D  LK EL   I   GFE PS +Q +A+   + G D++AQA+SG GK  + ++
Sbjct: 38  FQDFCLKSELANAIRENGFEHPSEVQHQALPKAMLGADILAQAKSGMGKTAVFVF 92



 Score = 34.3 bits (75), Expect = 3.1
 Identities = 23/72 (31%), Positives = 38/72 (52%), Gaps = 5/72 (6%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRE----CQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIG 418
           KTA F  ++L+Q++   +     CQA++L   RELA QI++       +L  A      G
Sbjct: 86  KTAVFVFALLEQVEKVPQGQKPYCQAVVLVHARELAYQIEQEFKRFSKYLPYATTGVFFG 145

Query: 419 GTNVREDIRQLE 454
           G    E+++QL+
Sbjct: 146 GIPEDENVKQLK 157


>UniRef50_A2DSJ0 Cluster: DEAD/DEAH box helicase family protein;
           n=1; Trichomonas vaginalis G3|Rep: DEAD/DEAH box
           helicase family protein - Trichomonas vaginalis G3
          Length = 515

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 20/52 (38%), Positives = 34/52 (65%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           VE+F+++ L   ++R ++   FE P+ +Q + I   +QGRDV A A +G+GK
Sbjct: 15  VESFEELGLSHSIIRALHKMNFEIPTPVQNKTIPIALQGRDVCASAVTGSGK 66



 Score = 32.7 bits (71), Expect = 9.5
 Identities = 27/87 (31%), Positives = 45/87 (51%), Gaps = 4/87 (4%)
 Frame = +2

Query: 203 ALHPRTRCYRSSPVRNWKTATFSISILQQI---DTSIRECQALILAPTRELAQQIQKVVI 373
           AL  R  C  S+   + KTA F I  ++++    ++  + +A+IL+PTRELA Q   V+ 
Sbjct: 50  ALQGRDVC-ASAVTGSGKTAAFLIPTVERLLRSKSTEAQTRAVILSPTRELAAQTYSVLS 108

Query: 374 ALGDHLNAKCHACIGG-TNVREDIRQL 451
            +            GG +NV+E+  +L
Sbjct: 109 QIIQFTPLTALLLTGGSSNVKEEEERL 135


>UniRef50_A0EIJ0 Cluster: Chromosome undetermined scaffold_99, whole
           genome shotgun sequence; n=3; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_99,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 706

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 24/60 (40%), Positives = 36/60 (60%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSLYRFYNK 290
           F+ M L  EL R I + GF  P+ IQ++AI   + GRD++A +++G+GK    L    NK
Sbjct: 12  FESMGLIPELYRAIKSQGFNVPTPIQRKAIPQILAGRDIVACSKTGSGKTAAFLIPLINK 71



 Score = 34.3 bits (75), Expect = 3.1
 Identities = 21/58 (36%), Positives = 33/58 (56%), Gaps = 2/58 (3%)
 Frame = +2

Query: 254 KTATFSISILQQID--TSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 421
           KTA F I ++ ++   +++   + LIL PTRELA QI  V+ AL    + +    +GG
Sbjct: 60  KTAAFLIPLINKLQNHSTVVGIRGLILLPTRELALQIASVLKALLKFSDIQYSIMVGG 117


>UniRef50_A0BPV0 Cluster: Chromosome undetermined scaffold_12, whole
           genome shotgun sequence; n=4; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_12,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 471

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 22/52 (42%), Positives = 32/52 (61%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           V  F +  LKEELLR +   GFE P+ +Q  ++   + G  +I QA++GTGK
Sbjct: 72  VSQFKNFGLKEELLRAVKEAGFEHPTRVQAESLTNALLGEQLICQAKAGTGK 123



 Score = 41.9 bits (94), Expect = 0.016
 Identities = 23/69 (33%), Positives = 38/69 (55%), Gaps = 2/69 (2%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI--GGTN 427
           KTA F +++L  I+T   + + L++  TRELAQQ +   + LG  + +    C   GG  
Sbjct: 123 KTAVFVLTVLNTINTESNKVECLVITHTRELAQQARDEFLRLGKFMKSVKVECFYGGGEP 182

Query: 428 VREDIRQLE 454
           V  +I+ +E
Sbjct: 183 VSVNIQTIE 191


>UniRef50_P21693 Cluster: ATP-independent RNA helicase dbpA; n=195;
           cellular organisms|Rep: ATP-independent RNA helicase
           dbpA - Escherichia coli (strain K12)
          Length = 457

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 27/57 (47%), Positives = 34/57 (59%), Gaps = 1/57 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGG 421
           KTA F + +LQQID S+ + QAL+L PTRELA Q+   +  L   L N K     GG
Sbjct: 53  KTAAFGLGLLQQIDASLFQTQALVLCPTRELADQVAGELRRLARFLPNTKILTLCGG 109


>UniRef50_Q64VR8 Cluster: ATP-dependent RNA helicase DeaD; n=14;
           Bacteria|Rep: ATP-dependent RNA helicase DeaD -
           Bacteroides fragilis
          Length = 427

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 27/75 (36%), Positives = 47/75 (62%), Gaps = 8/75 (10%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK-------LLL 266
           TF+++NL E +L+ +   G+  P+ IQ+++I   +QG+D++  AQ+GTGK       +L 
Sbjct: 2   TFENLNLIEPILKALRQEGYTSPTPIQEQSIPILLQGKDLLGCAQTGTGKTAAFSIPILQ 61

Query: 267 SLYRF-YNKSIQAFV 308
            LY+  + K I+A V
Sbjct: 62  KLYKTDHRKGIKALV 76



 Score = 40.7 bits (91), Expect = 0.036
 Identities = 29/58 (50%), Positives = 36/58 (62%), Gaps = 2/58 (3%)
 Frame = +2

Query: 254 KTATFSISILQQI-DTSIRE-CQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 421
           KTA FSI ILQ++  T  R+  +AL+L PTRELA QI +   A G +   K HA I G
Sbjct: 51  KTAAFSIPILQKLYKTDHRKGIKALVLTPTRELAIQIGESFEAYGRYTGLK-HAVIFG 107


>UniRef50_Q5NN72 Cluster: DNA and RNA helicase; n=3;
           Sphingomonadales|Rep: DNA and RNA helicase - Zymomonas
           mobilis
          Length = 492

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 22/50 (44%), Positives = 34/50 (68%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +F D+ L +ELL+ +   G+E+P+ +Q  AI   +  RD+IA AQ+GTGK
Sbjct: 2   SFADLGLSKELLQAVAELGYEEPTPVQAAAIPSVLMMRDLIAVAQTGTGK 51


>UniRef50_O83749 Cluster: ATP-dependent RNA helicase; n=2;
           Treponema|Rep: ATP-dependent RNA helicase - Treponema
           pallidum
          Length = 649

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 23/67 (34%), Positives = 37/67 (55%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTA F + ++Q++ +      AL+L PTRELA Q+   + +L      + H   GG ++ 
Sbjct: 97  KTAAFGLPLIQELGSPCEHPGALVLVPTRELAAQVASELSSLRIQKIPRIHTVYGGVSIA 156

Query: 434 EDIRQLE 454
           E +R LE
Sbjct: 157 EQLRNLE 163


>UniRef50_A7JLA3 Cluster: ATP-dependent RNA helicase; n=20;
           Francisella|Rep: ATP-dependent RNA helicase -
           Francisella tularensis subsp. novicida GA99-3548
          Length = 569

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 21/49 (42%), Positives = 32/49 (65%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F  + L ++++  +   G+E P+ IQQ AI   + GRDV+ QAQ+GTGK
Sbjct: 9   FSQLGLNQDIVDTVIKLGYENPTPIQQYAIPYILSGRDVLGQAQTGTGK 57



 Score = 40.7 bits (91), Expect = 0.036
 Identities = 26/70 (37%), Positives = 39/70 (55%), Gaps = 3/70 (4%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIREC--QALILAPTRELAQQIQKVVIALGDHLNAKCHACI-GGT 424
           KTA F++ ++  +D + R+   Q L+LAPTRELA Q+ +   A   ++     ACI GG 
Sbjct: 57  KTAAFALPLINNMDLASRDRAPQVLVLAPTRELAIQVAEQFEAFAKNVPNLDVACIYGGQ 116

Query: 425 NVREDIRQLE 454
                IR L+
Sbjct: 117 EYGSQIRALK 126


>UniRef50_A6VTY7 Cluster: DEAD/DEAH box helicase domain protein;
           n=48; root|Rep: DEAD/DEAH box helicase domain protein -
           Marinomonas sp. MWYL1
          Length = 463

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 22/50 (44%), Positives = 35/50 (70%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +F+ + L   +L+ I   G+ +PSAIQ +AI   ++G+DV+A AQ+GTGK
Sbjct: 6   SFNKLGLSAPILKAIEDQGYTEPSAIQAQAIPAILEGQDVMAAAQTGTGK 55



 Score = 42.3 bits (95), Expect = 0.012
 Identities = 23/70 (32%), Positives = 37/70 (52%), Gaps = 4/70 (5%)
 Frame = +2

Query: 254 KTATFSISILQQI----DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 421
           KTA F++ +L+ +    +    + +AL+L PTRELA Q+ + V   G HL+ K     GG
Sbjct: 55  KTAGFTLPLLEILSKGENAQSNQVRALVLTPTRELAAQVAESVKNYGQHLSLKSTVVFGG 114

Query: 422 TNVREDIRQL 451
             +   +  L
Sbjct: 115 VKINPQMMAL 124


>UniRef50_A5FST0 Cluster: DEAD/DEAH box helicase domain protein;
           n=8; Bacteria|Rep: DEAD/DEAH box helicase domain protein
           - Dehalococcoides sp. BAV1
          Length = 561

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 21/50 (42%), Positives = 33/50 (66%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +F+  N    ++ G+ A G+++P+ IQ +AI P + G DVI  AQ+GTGK
Sbjct: 2   SFESFNFDPAVMAGVRACGYKEPTPIQAQAIPPIMAGHDVIGLAQTGTGK 51



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 24/67 (35%), Positives = 41/67 (61%), Gaps = 1/67 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIR-ECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 430
           KTA +++ I+Q++ ++ R   + L++APTRELA QI     +LG     +  +  GG N+
Sbjct: 51  KTAAYALPIIQKMLSTPRGRVRTLVIAPTRELACQISDSFRSLGQRARIRECSIYGGVNM 110

Query: 431 REDIRQL 451
            + IR+L
Sbjct: 111 DQQIRRL 117


>UniRef50_Q96GQ7 Cluster: Probable ATP-dependent RNA helicase DDX27;
           n=34; Bilateria|Rep: Probable ATP-dependent RNA helicase
           DDX27 - Homo sapiens (Human)
          Length = 796

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 23/50 (46%), Positives = 33/50 (66%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +F DMNL   LL+ I A GF++P+ IQ+  I   + G+D+ A A +GTGK
Sbjct: 219 SFQDMNLSRPLLKAITAMGFKQPTPIQKACIPVGLLGKDICACAATGTGK 268



 Score = 37.5 bits (83), Expect = 0.33
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 3/63 (4%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIREC---QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 424
           KTA F++ +L+++    R+    + L+L PTREL  Q+  V   L    N      +GG 
Sbjct: 268 KTAAFALPVLERLIYKPRQAPVTRVLVLVPTRELGIQVHSVTRQLAQFCNITTCLAVGGL 327

Query: 425 NVR 433
           +V+
Sbjct: 328 DVK 330


>UniRef50_A4QTR1 Cluster: ATP-dependent RNA helicase DBP9; n=4;
           Ascomycota|Rep: ATP-dependent RNA helicase DBP9 -
           Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 636

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 20/50 (40%), Positives = 35/50 (70%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +F D+ L   LL+ +    F+KP+ +Q +AI   ++GRDV+A+A++G+GK
Sbjct: 44  SFADLGLDPRLLQAVAQQSFQKPTLVQSKAIPLALEGRDVLAKAKTGSGK 93


>UniRef50_UPI0000D5571E Cluster: PREDICTED: similar to CG5800-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG5800-PA - Tribolium castaneum
          Length = 770

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 21/57 (36%), Positives = 36/57 (63%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           + +FDD+ L  + L+G+   G+ KP+ IQ+  I   + G+D++  AQ+G+GK L  L
Sbjct: 50  INSFDDLPLSPKTLKGLKECGYTKPTDIQRETIKLGLTGKDILGAAQTGSGKTLAFL 106



 Score = 36.3 bits (80), Expect = 0.77
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 4/71 (5%)
 Frame = +2

Query: 254 KTATFSISILQQID----TSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 421
           KT  F I IL+++     T +    AL++ PTRELA QI + +  +G+H        IGG
Sbjct: 101 KTLAFLIPILERLYCKQWTRLDGLGALVITPTRELAYQIFEELRRVGEHHEFSAGLIIGG 160

Query: 422 TNVREDIRQLE 454
            +++ +  +++
Sbjct: 161 KDLKFERNRMD 171


>UniRef50_UPI00006CDDA3 Cluster: CLN3 protein; n=1; Tetrahymena
           thermophila SB210|Rep: CLN3 protein - Tetrahymena
           thermophila SB210
          Length = 1138

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 24/59 (40%), Positives = 39/59 (66%), Gaps = 1/59 (1%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPC-IQGRDVIAQAQSGTGKLLLSLY 275
           + +F  +   EEL+R I   GFEKP+ IQ +A +PC + GRD++  A++G+GK +  L+
Sbjct: 61  IVSFGHLGFDEELMRQITKLGFEKPTQIQCQA-LPCGLSGRDIVGVAKTGSGKTVSYLW 118



 Score = 32.7 bits (71), Expect = 9.5
 Identities = 23/62 (37%), Positives = 28/62 (45%), Gaps = 1/62 (1%)
 Frame = +2

Query: 272 ISILQQIDTSIRECQ-ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQ 448
           I IL Q +    E    LILAPTREL QQ+           N    A +GG N  E  + 
Sbjct: 122 IHILDQRELEKNEGPIGLILAPTRELCQQVYTESKRYAKIYNISVGALLGGENKHEQWKM 181

Query: 449 LE 454
           L+
Sbjct: 182 LK 183


>UniRef50_UPI00006CBDDC Cluster: DEAD/DEAH box helicase family
           protein; n=1; Tetrahymena thermophila SB210|Rep:
           DEAD/DEAH box helicase family protein - Tetrahymena
           thermophila SB210
          Length = 598

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 22/63 (34%), Positives = 39/63 (61%), Gaps = 4/63 (6%)
 Frame = +2

Query: 278 ILQQIDTSIREC-QALILAPTRELAQQIQKVVIALGDHL---NAKCHACIGGTNVREDIR 445
           +++Q+ T+ + C  AL++APTRELA+QI ++ + L  HL         CIGG + + D+ 
Sbjct: 71  LIKQVKTANKNCVYALVIAPTRELAKQIHEIAVQLASHLENNQFSIQLCIGGVSTKIDVS 130

Query: 446 QLE 454
            ++
Sbjct: 131 NIQ 133


>UniRef50_Q9PGP6 Cluster: ATP-dependent RNA helicase; n=10; cellular
           organisms|Rep: ATP-dependent RNA helicase - Xylella
           fastidiosa
          Length = 614

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 21/49 (42%), Positives = 31/49 (63%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D+ L + +++ +   G+E PS IQ   I   + GRDV+ QAQ+GTGK
Sbjct: 17  FADLGLSDAVMQAVTKIGYETPSPIQAATIPALLAGRDVLGQAQTGTGK 65



 Score = 32.7 bits (71), Expect = 9.5
 Identities = 16/35 (45%), Positives = 24/35 (68%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQI 358
           KTA F++ +L +   +  + Q L+LAPTRELA Q+
Sbjct: 65  KTAAFALPLLTRTVLNQVKPQVLVLAPTRELAIQV 99


>UniRef50_Q6MR64 Cluster: ATP-dependent RNA helicase; n=5; cellular
           organisms|Rep: ATP-dependent RNA helicase - Bdellovibrio
           bacteriovorus
          Length = 505

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 29/72 (40%), Positives = 37/72 (51%), Gaps = 5/72 (6%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQ-----ALILAPTRELAQQIQKVVIALGDHLNAKCHACIG 418
           KTA FS+ ILQ +    R+ +      LIL PTRELA QI + + A   HLN K     G
Sbjct: 54  KTAAFSLPILQNLSKHTRKIEPKSPRCLILTPTRELAIQIHENIEAYSKHLNMKHAVIFG 113

Query: 419 GTNVREDIRQLE 454
           G      +R L+
Sbjct: 114 GVGQNPQVRALQ 125



 Score = 37.5 bits (83), Expect = 0.33
 Identities = 19/49 (38%), Positives = 28/49 (57%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D+ L   L   +   G+E P+ IQ  AI   ++G D++  AQ+GTGK
Sbjct: 6   FTDLPLIAPLQFSLKEAGYETPTPIQLAAIPVILEGHDLLGIAQTGTGK 54


>UniRef50_Q1N6E2 Cluster: ATP-dependent RNA helicase; n=1;
           Oceanobacter sp. RED65|Rep: ATP-dependent RNA helicase -
           Oceanobacter sp. RED65
          Length = 475

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 24/71 (33%), Positives = 37/71 (52%)
 Frame = +3

Query: 45  TMDLREWTLGHLHTDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRD 224
           T  + +W++     +  +    F D NL   ++R I   GF   S IQ  A+   + GRD
Sbjct: 78  TPPMGDWSVDQFKVEPAEGKVRFHDFNLDARIMRSIQDLGFSYASPIQAEALPYTLAGRD 137

Query: 225 VIAQAQSGTGK 257
           +I +AQ+GTGK
Sbjct: 138 IIGKAQTGTGK 148



 Score = 43.2 bits (97), Expect = 0.007
 Identities = 29/73 (39%), Positives = 39/73 (53%), Gaps = 6/73 (8%)
 Frame = +2

Query: 254 KTATFSISILQQIDTS------IRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI 415
           KTA F I++LQ++ T         E +ALILAPTRELA QI K    L  + +      +
Sbjct: 148 KTAAFLITVLQKLLTVKPEERFASEPRALILAPTRELAMQIAKDADGLSKYADLNIVTVL 207

Query: 416 GGTNVREDIRQLE 454
           GG +  +   QLE
Sbjct: 208 GGVDYDKQKEQLE 220


>UniRef50_A4BET4 Cluster: DEAD/DEAH box helicase-like protein; n=1;
           Reinekea sp. MED297|Rep: DEAD/DEAH box helicase-like
           protein - Reinekea sp. MED297
          Length = 579

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 22/50 (44%), Positives = 33/50 (66%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           TF D+ L   LL+ + + G+E P+ IQ +AI+  + G DV+  AQ+GTGK
Sbjct: 6   TFADLGLAPVLLKTLDSLGYETPTPIQSQAIVQLLDGNDVLGLAQTGTGK 55



 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 26/68 (38%), Positives = 39/68 (57%), Gaps = 1/68 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA FS+ +L +IDT+  + QAL+L PTRELA Q+ +        + N       GG ++
Sbjct: 55  KTAAFSLPLLSRIDTTKNKPQALVLCPTRELAIQVAEAFQTYARGVDNFHVLPIYGGADM 114

Query: 431 REDIRQLE 454
           R  +R L+
Sbjct: 115 RNQLRALK 122


>UniRef50_Q55BR9 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 508

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 27/63 (42%), Positives = 36/63 (57%)
 Frame = +2

Query: 233 SSPVRNWKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHAC 412
           S+   + KTA+F+I IL Q+        A+IL PTRELA QI +   A+G  +N  C   
Sbjct: 47  SAKTGSGKTASFAIPILNQLSEDPYGVFAVILTPTRELAVQIGEQFNAIGAPMNVNCSVV 106

Query: 413 IGG 421
           IGG
Sbjct: 107 IGG 109



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 20/51 (39%), Positives = 32/51 (62%)
 Frame = +3

Query: 105 ETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +TF+++ L   L+      GF+ PS IQ   I   ++GRD+IA A++G+GK
Sbjct: 4   KTFEELGLTTWLVANCKQLGFKAPSNIQANTIPEILKGRDIIASAKTGSGK 54


>UniRef50_Q03532 Cluster: ATP-dependent RNA helicase HAS1; n=70;
           Eukaryota|Rep: ATP-dependent RNA helicase HAS1 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 505

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 22/57 (38%), Positives = 35/57 (61%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           VE F+++ L +  L+ I   GF   +++Q R I P + GRDV+  A++G+GK L  L
Sbjct: 41  VEKFEELKLSQPTLKAIEKMGFTTMTSVQARTIPPLLAGRDVLGAAKTGSGKTLAFL 97


>UniRef50_Q11UI8 Cluster: DEAD box-related helicase; n=3;
           Sphingobacteriales|Rep: DEAD box-related helicase -
           Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)
          Length = 437

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 24/65 (36%), Positives = 36/65 (55%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSLYRFYN 287
           TF+D N    LL  + + GF KP+ IQ  AI   +   D++A AQ+GTGK    +    +
Sbjct: 2   TFNDFNFNSGLLDSLSSMGFNKPTPIQTEAIPVIMSNSDLVACAQTGTGKTAAYMLPILH 61

Query: 288 KSIQA 302
           K I++
Sbjct: 62  KIIES 66



 Score = 35.9 bits (79), Expect = 1.0
 Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 1/57 (1%)
 Frame = +2

Query: 254 KTATFSISILQQI-DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 421
           KTA + + IL +I +++      L+L PTRELA QI + +      +N    A  GG
Sbjct: 51  KTAAYMLPILHKIIESNTDSLDTLVLVPTRELAIQIDQQIEGFSYFINVSSIAVYGG 107


>UniRef50_A7HKQ8 Cluster: DEAD/DEAH box helicase domain protein;
           n=1; Fervidobacterium nodosum Rt17-B1|Rep: DEAD/DEAH box
           helicase domain protein - Fervidobacterium nodosum
           Rt17-B1
          Length = 571

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 24/52 (46%), Positives = 34/52 (65%), Gaps = 1/52 (1%)
 Frame = +3

Query: 105 ETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQ-GRDVIAQAQSGTGK 257
           E F+D  L EE+L  I   G+EKP+ IQ+  +   +   +D+IAQAQ+GTGK
Sbjct: 18  ERFEDFGLSEEILLAIQKKGYEKPTEIQKIVLPYALSTDKDLIAQAQTGTGK 69



 Score = 41.9 bits (94), Expect = 0.016
 Identities = 24/68 (35%), Positives = 38/68 (55%), Gaps = 1/68 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRE-CQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 430
           KTA F I +L++ID    +  +A+I+ PTRELA QI + + +L      K     GG ++
Sbjct: 69  KTAAFGIPLLERIDFKANKFVKAIIVTPTRELALQIFEELKSLKGTKRVKITTLYGGQSL 128

Query: 431 REDIRQLE 454
            +  + LE
Sbjct: 129 EKQFKDLE 136


>UniRef50_A7HG33 Cluster: DEAD/DEAH box helicase domain protein;
           n=5; Cystobacterineae|Rep: DEAD/DEAH box helicase domain
           protein - Anaeromyxobacter sp. Fw109-5
          Length = 455

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 22/50 (44%), Positives = 32/50 (64%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +F +++L  E L  +   GFE P+ IQ +AI P + G+DVI  A +GTGK
Sbjct: 5   SFAELHLSPEALAALRRAGFEHPTPIQAQAIPPALAGKDVIGTAATGTGK 54



 Score = 34.3 bits (75), Expect = 3.1
 Identities = 21/66 (31%), Positives = 33/66 (50%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTA F + ++ ++       +AL+LAPTRELA QI + +   G     +    IGG  + 
Sbjct: 54  KTAAFLLPLIDRL-AGKPGTRALVLAPTRELALQIGEELERFGHARRVRGAVIIGGVGMA 112

Query: 434 EDIRQL 451
           +    L
Sbjct: 113 QQAEAL 118


>UniRef50_A5UZK3 Cluster: DEAD/DEAH box helicase domain protein;
           n=12; Bacteria|Rep: DEAD/DEAH box helicase domain
           protein - Roseiflexus sp. RS-1
          Length = 467

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 27/67 (40%), Positives = 40/67 (59%), Gaps = 1/67 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIR-ECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 430
           KTA F + ILQ++    R   +A+I+ PTRELA+QIQ V+ ALG +   +     GG   
Sbjct: 51  KTAAFVLPILQRLMRGPRGRVRAMIVTPTRELAEQIQGVIEALGKYTGLRSVTLYGGVGY 110

Query: 431 REDIRQL 451
           +  I++L
Sbjct: 111 QGQIQRL 117



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 20/50 (40%), Positives = 29/50 (58%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +FD      ++  GI   G+  P+ IQ++ I   + GRDVI  AQ+GTGK
Sbjct: 2   SFDSFRFHPQITAGIRDLGYHTPTPIQEQVIPHALDGRDVIGIAQTGTGK 51


>UniRef50_Q9V3C4 Cluster: CG6539-PA; n=1; Drosophila
           melanogaster|Rep: CG6539-PA - Drosophila melanogaster
           (Fruit fly)
          Length = 1028

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 25/67 (37%), Positives = 41/67 (61%), Gaps = 1/67 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIAL-GDHLNAKCHACIGGTNV 430
           KT  + I+++Q  + +I +  A+I+ PTRELA Q+Q     L     + KC A IGGT+V
Sbjct: 75  KTLIYVIAVVQSFNPNINQPHAMIVVPTRELAIQVQDTFFHLCKSFRDFKCSAFIGGTDV 134

Query: 431 REDIRQL 451
            +D +++
Sbjct: 135 AKDRKRM 141


>UniRef50_A5DPU0 Cluster: ATP-dependent RNA helicase MAK5; n=1;
           Pichia guilliermondii|Rep: ATP-dependent RNA helicase
           MAK5 - Pichia guilliermondii (Yeast) (Candida
           guilliermondii)
          Length = 754

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 23/62 (37%), Positives = 40/62 (64%)
 Frame = +3

Query: 78  LHTDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           L  D D    + ++++L    + G+   GF++P+AIQ++AI   +QG+DVI +A +G+GK
Sbjct: 175 LPKDTDLPKWSMENVSLSTYTINGLAGCGFKEPTAIQRKAIPLALQGKDVIGKATTGSGK 234

Query: 258 LL 263
            L
Sbjct: 235 TL 236


>UniRef50_UPI0000DB7226 Cluster: PREDICTED: similar to Probable
           ATP-dependent RNA helicase DDX20 (DEAD box protein 20)
           (DEAD box protein DP 103) (Component of gems 3)
           (Gemin-3); n=1; Apis mellifera|Rep: PREDICTED: similar
           to Probable ATP-dependent RNA helicase DDX20 (DEAD box
           protein 20) (DEAD box protein DP 103) (Component of gems
           3) (Gemin-3) - Apis mellifera
          Length = 648

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 27/67 (40%), Positives = 38/67 (56%), Gaps = 1/67 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KT  F I  L+ ID  I   Q LILAPTRE+A QI +V  ++G  + + K    IGG  +
Sbjct: 46  KTLVFCIISLEMIDIDISSVQVLILAPTREIAVQIAQVFSSVGCEIKDLKVEVFIGGLAI 105

Query: 431 REDIRQL 451
             D +++
Sbjct: 106 ENDKKKV 112



 Score = 41.9 bits (94), Expect = 0.016
 Identities = 21/49 (42%), Positives = 32/49 (65%)
 Frame = +3

Query: 120 MNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLL 266
           M   +++L G+   GF++PS IQ +AI     G D+I +A+SGTGK L+
Sbjct: 1   MGFSQKILDGLSVCGFQRPSPIQLKAIPLGRCGFDLIMRAKSGTGKTLV 49


>UniRef50_UPI0000DAE40A Cluster: hypothetical protein
           Rgryl_01000266; n=1; Rickettsiella grylli|Rep:
           hypothetical protein Rgryl_01000266 - Rickettsiella
           grylli
          Length = 433

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 21/54 (38%), Positives = 33/54 (61%)
 Frame = +3

Query: 96  QVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +++  F + N   ++L GI   G+   + IQ +AI   +QGRDV+  AQ+GTGK
Sbjct: 10  ELLVNFTEFNFNTQILSGIQTQGYRTATPIQIKAIPAILQGRDVVGLAQTGTGK 63



 Score = 39.5 bits (88), Expect = 0.083
 Identities = 21/57 (36%), Positives = 34/57 (59%), Gaps = 1/57 (1%)
 Frame = +2

Query: 254 KTATFSISILQQI-DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 421
           KTA +++ +LQQ+ +    + +ALIL+PTR+LA QI   +   G   + +C    GG
Sbjct: 63  KTAAYALPLLQQLTEGPPGQLRALILSPTRDLADQICVAMNHFGRQTHLRCATIYGG 119


>UniRef50_Q6MN67 Cluster: ATP-dependent RNA helicase; n=3;
           Deltaproteobacteria|Rep: ATP-dependent RNA helicase -
           Bdellovibrio bacteriovorus
          Length = 505

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 31/68 (45%), Positives = 37/68 (54%), Gaps = 1/68 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA FS+ IL +I+      QALIL PTRELA Q+   +  LG  L   K  A  GG + 
Sbjct: 97  KTAAFSLPILNKINLDQPLLQALILCPTRELASQVVTEIRKLGRRLPGLKVLAMTGGQSG 156

Query: 431 REDIRQLE 454
           RE    LE
Sbjct: 157 REQADALE 164



 Score = 41.9 bits (94), Expect = 0.016
 Identities = 20/49 (40%), Positives = 30/49 (61%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F  + L  ELL  +   GFE  + IQQ +I   + G+D+I QA++G+GK
Sbjct: 49  FSTLPLSPELLTVVQELGFETLTPIQQESIPLLLAGKDIIGQAKTGSGK 97


>UniRef50_O34750 Cluster: YfmL protein; n=5; Bacillus|Rep: YfmL
           protein - Bacillus subtilis
          Length = 376

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 24/73 (32%), Positives = 42/73 (57%)
 Frame = +2

Query: 236 SPVRNWKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI 415
           SP    KT  +++ +L++I    +  QA+ILAP+REL  QI +V+         +  + I
Sbjct: 48  SPTGTGKTLAYALPVLERIKPEQKHPQAVILAPSRELVMQIFQVIQDWKAGSELRAASLI 107

Query: 416 GGTNVREDIRQLE 454
           GG NV++ + +L+
Sbjct: 108 GGANVKKQVEKLK 120



 Score = 41.5 bits (93), Expect = 0.021
 Identities = 17/36 (47%), Positives = 27/36 (75%)
 Frame = +3

Query: 156 AYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           A GF+KP+ +Q++A    + G+DVIA++ +GTGK L
Sbjct: 21  ASGFQKPTPVQEQAAQLIMDGKDVIAESPTGTGKTL 56


>UniRef50_Q0FAJ4 Cluster: Dead-box ATP-dependent RNA helicase; n=6;
           Alphaproteobacteria|Rep: Dead-box ATP-dependent RNA
           helicase - alpha proteobacterium HTCC2255
          Length = 531

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 27/71 (38%), Positives = 40/71 (56%), Gaps = 5/71 (7%)
 Frame = +2

Query: 254 KTATFSISILQQ-----IDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIG 418
           KTA F++ ++QQ     I    R  +A+IL+PTRELA QI +  ++ G  L       IG
Sbjct: 153 KTAAFALPLIQQLLMNPIAIKGRSARAIILSPTRELALQIHEAFVSFGKRLPLNFTHAIG 212

Query: 419 GTNVREDIRQL 451
           G  +R+ +R L
Sbjct: 213 GAPIRKQMRDL 223



 Score = 38.7 bits (86), Expect = 0.14
 Identities = 16/49 (32%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F  + L  E+++ +   G+  P+ IQ +AI   +  +D++  AQ+GTGK
Sbjct: 105 FSKLGLDAEIVKALGFLGYTLPTPIQSQAIPAVLNSKDLVGLAQTGTGK 153


>UniRef50_A6G4U7 Cluster: DEAD/DEAH box helicase; n=2; Plesiocystis
           pacifica SIR-1|Rep: DEAD/DEAH box helicase -
           Plesiocystis pacifica SIR-1
          Length = 1390

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 22/55 (40%), Positives = 33/55 (60%)
 Frame = +3

Query: 93  DQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           D   ET+D+M L E +   + A G+  P+ +Q R     IQG DV+ Q+Q+G+GK
Sbjct: 152 DPAPETWDEMALPEHVRNAVDAAGWTAPTKVQARTYETMIQGTDVLVQSQTGSGK 206


>UniRef50_Q7QNT5 Cluster: GLP_88_2286_3572; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_88_2286_3572 - Giardia lamblia ATCC
           50803
          Length = 428

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 22/49 (44%), Positives = 33/49 (67%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F+D+    +L++ IY YGFE PS +QQ +I   IQG+ +   AQ+G+GK
Sbjct: 6   FEDL-ASFDLIKAIYKYGFEIPSPVQQYSIPKLIQGQSISVNAQTGSGK 53



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 21/66 (31%), Positives = 35/66 (53%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTA F IS+L  ++     CQA+I++PT+EL+ Q  +V+  LG     +      G   +
Sbjct: 53  KTAAFGISLLSLVNPQKSICQAVIISPTKELSNQTLEVINTLGTRSGIRGVCLTSGVMAK 112

Query: 434 EDIRQL 451
           E   ++
Sbjct: 113 EQFEKI 118


>UniRef50_Q7Q0A7 Cluster: ENSANGP00000011621; n=5;
           Endopterygota|Rep: ENSANGP00000011621 - Anopheles
           gambiae str. PEST
          Length = 523

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 25/59 (42%), Positives = 37/59 (62%), Gaps = 2/59 (3%)
 Frame = +2

Query: 236 SPVRNWKTATFSISILQQIDTSIREC--QALILAPTRELAQQIQKVVIALGDHLNAKCH 406
           +P  + KTA F I IL  +   ++ C  +ALI+ PTRELA+Q Q+  + LGD +N + H
Sbjct: 186 APTGSGKTAAFLIPILHHLKKPMK-CGFRALIICPTRELAKQTQREALRLGDEMNLRTH 243


>UniRef50_A0RUV7 Cluster: Superfamily II helicase; n=3;
           Thermoprotei|Rep: Superfamily II helicase - Cenarchaeum
           symbiosum
          Length = 434

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 21/49 (42%), Positives = 32/49 (65%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F+++ +K+ +L  +   GFEK   IQ+ AI   + GRDV+ QA +GTGK
Sbjct: 4   FEELGIKQNVLDALRDMGFEKAFPIQEAAIPVLLTGRDVVGQAHTGTGK 52



 Score = 39.1 bits (87), Expect = 0.11
 Identities = 24/59 (40%), Positives = 33/59 (55%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 430
           KT  +SIS+LQ+I       Q LI+APTRELA QI + V     +   +  A  GG ++
Sbjct: 52  KTGAYSISMLQEIKEG-GGIQGLIVAPTRELAVQITEEVKKFAKYTKVRPVAIYGGQSM 109


>UniRef50_O22907 Cluster: DEAD-box ATP-dependent RNA helicase 24;
           n=7; Magnoliophyta|Rep: DEAD-box ATP-dependent RNA
           helicase 24 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 760

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 22/57 (38%), Positives = 36/57 (63%)
 Frame = +3

Query: 87  DWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           D  + V+TF+D     +++  I    +EKP+AIQ +A+   + GRDVI  A++G+GK
Sbjct: 222 DVHRPVKTFEDCGFSSQIMSAIKKQAYEKPTAIQCQALPIVLSGRDVIGIAKTGSGK 278


>UniRef50_P32892 Cluster: ATP-dependent RNA helicase DRS1; n=13;
           Saccharomycetales|Rep: ATP-dependent RNA helicase DRS1 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 752

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 21/54 (38%), Positives = 35/54 (64%)
 Frame = +3

Query: 96  QVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           Q+ E F+ ++L   +L+G+ + G+ KPS IQ   I   + G+D+IA A +G+GK
Sbjct: 228 QMYENFNSLSLSRPVLKGLASLGYVKPSPIQSATIPIALLGKDIIAGAVTGSGK 281



 Score = 33.9 bits (74), Expect = 4.1
 Identities = 21/71 (29%), Positives = 37/71 (52%), Gaps = 4/71 (5%)
 Frame = +2

Query: 254 KTATFSISILQQI---DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHA-CIGG 421
           KTA F I I++++      I   + ++L PTRELA Q+  V   +   ++       +GG
Sbjct: 281 KTAAFMIPIIERLLYKPAKIASTRVIVLLPTRELAIQVADVGKQIARFVSGITFGLAVGG 340

Query: 422 TNVREDIRQLE 454
            N+R+  + L+
Sbjct: 341 LNLRQQEQMLK 351


>UniRef50_P0C2N8 Cluster: ATP-dependent RNA helicase drs-1; n=16;
           Fungi/Metazoa group|Rep: ATP-dependent RNA helicase
           drs-1 - Neurospora crassa
          Length = 829

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 20/52 (38%), Positives = 34/52 (65%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           + +F +M+L   +LRG+ + GF KP+ IQ + I   + G+DV+  A +G+GK
Sbjct: 292 MSSFQEMSLSRPILRGLTSVGFTKPTPIQAKTIPISLMGKDVVGGAVTGSGK 343



 Score = 39.9 bits (89), Expect = 0.063
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 3/63 (4%)
 Frame = +2

Query: 254 KTATFSISILQQI---DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 424
           KTA F + IL+++      +   + +IL PTRELA Q   V + L  H + K    +GG 
Sbjct: 343 KTAAFVVPILERLLYRPKKVPTTRVVILTPTRELAIQCHAVAVKLASHTDIKFCLAVGGL 402

Query: 425 NVR 433
           +++
Sbjct: 403 SLK 405


>UniRef50_Q4V836 Cluster: MGC114699 protein; n=9; Deuterostomia|Rep:
           MGC114699 protein - Xenopus laevis (African clawed frog)
          Length = 758

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 23/50 (46%), Positives = 31/50 (62%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           TF DMNL   LL+ I A  F +P+ IQ+  I   + G+D+ A A +GTGK
Sbjct: 182 TFQDMNLSRPLLKAISAMSFTQPTPIQKACIPVGLLGKDICACAATGTGK 231



 Score = 35.5 bits (78), Expect = 1.3
 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 3/63 (4%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIREC---QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 424
           KTA F + +L+++    RE    + L+L PTREL  Q+  V   L           +GG 
Sbjct: 231 KTAAFMLPVLERLIYKPREAPVTRVLVLVPTRELGIQVHAVTRQLAQFTEVTTCLAVGGL 290

Query: 425 NVR 433
           +V+
Sbjct: 291 DVK 293


>UniRef50_Q4RK69 Cluster: Chromosome 2 SCAF15032, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 2 SCAF15032, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 574

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 21/49 (42%), Positives = 32/49 (65%)
 Frame = +3

Query: 126 LKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           + E  L+G+   GFE  + IQ + I P ++GRDV+A A++G+GK L  L
Sbjct: 68  VSENTLKGVKELGFEHMTEIQHKTIRPLLEGRDVLAAAKTGSGKTLAFL 116


>UniRef50_Q8D3Y6 Cluster: ATP-dependent RNA helicase, DEAD box
           family; n=8; Gammaproteobacteria|Rep: ATP-dependent RNA
           helicase, DEAD box family - Vibrio vulnificus
          Length = 447

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 22/63 (34%), Positives = 39/63 (61%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSLYRFYNK 290
           F D+ L   LL+ +    F+K + IQQ+AI   I G+D++A +++G+GK L  +    +K
Sbjct: 7   FKDLGLDNRLLKNLKHLDFQKATKIQQQAIPVAIAGKDLLASSKTGSGKTLAFVLPMLHK 66

Query: 291 SIQ 299
           S++
Sbjct: 67  SLK 69



 Score = 35.9 bits (79), Expect = 1.0
 Identities = 24/77 (31%), Positives = 41/77 (53%), Gaps = 4/77 (5%)
 Frame = +2

Query: 233 SSPVRNWKTATFSISILQQ-IDT---SIRECQALILAPTRELAQQIQKVVIALGDHLNAK 400
           SS   + KT  F + +L + + T   S R+ + +ILAPTRELA+Q+   +  +   L+  
Sbjct: 48  SSKTGSGKTLAFVLPMLHKSLKTKALSARDPRGVILAPTRELAKQVYGELRTMLGGLSYD 107

Query: 401 CHACIGGTNVREDIRQL 451
               +GG N  + ++ L
Sbjct: 108 ATLIVGGENFNDQVKAL 124


>UniRef50_Q3AX69 Cluster: DEAD/DEAH box helicase-like; n=15;
           Cyanobacteria|Rep: DEAD/DEAH box helicase-like -
           Synechococcus sp. (strain CC9902)
          Length = 624

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 26/67 (38%), Positives = 39/67 (58%), Gaps = 1/67 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIA-LGDHLNAKCHACIGGTNV 430
           KTA F++ +L+++++  +  Q L+LAPTRELA Q+     A    H + K  A  GGT+ 
Sbjct: 121 KTAAFALPLLERLESGQKTPQVLVLAPTRELAMQVADSFKAYAAGHPHLKVLAVYGGTDF 180

Query: 431 REDIRQL 451
           R  I  L
Sbjct: 181 RSQISTL 187



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 21/49 (42%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           FD     E LL+ +   G+  PS IQ+ A    + GRD++ QAQ+GTGK
Sbjct: 73  FDGFGFSEALLKTLADKGYSDPSPIQKAAFPELMLGRDLVGQAQTGTGK 121


>UniRef50_Q1VPX9 Cluster: ATP-independent RNA helicase; n=9;
           Bacteroidetes|Rep: ATP-independent RNA helicase -
           Psychroflexus torquis ATCC 700755
          Length = 443

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 27/68 (39%), Positives = 38/68 (55%)
 Frame = +2

Query: 236 SPVRNWKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI 415
           SP    KT  FS+ +L  +D    + Q LIL P+RELA QI++V+  +G     K +A  
Sbjct: 41  SPTGTGKTLAFSLPLLTILDPESPDVQVLILVPSRELAIQIEQVIRTMGS--GYKVNAVY 98

Query: 416 GGTNVRED 439
           GG  V +D
Sbjct: 99  GGRPVSKD 106


>UniRef50_Q08Q14 Cluster: HeliCase, c-terminal:dead/deah box
           helicase, n-terminal; n=3; Bacteria|Rep: HeliCase,
           c-terminal:dead/deah box helicase, n-terminal -
           Stigmatella aurantiaca DW4/3-1
          Length = 608

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 19/50 (38%), Positives = 34/50 (68%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           TF+ + L   L+  + A G+E+P+ IQ+ A+ P ++G+D++  A +GTGK
Sbjct: 37  TFESLGLLPPLVEALSALGYEEPTPIQRAALPPLLEGKDLLGIAATGTGK 86



 Score = 42.7 bits (96), Expect = 0.009
 Identities = 24/70 (34%), Positives = 35/70 (50%), Gaps = 3/70 (4%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRE---CQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 424
           KTA FS+ +LQ+I           AL+L PTRELA Q+ + +   G  L        GG 
Sbjct: 86  KTAAFSLPLLQRITPGAHAPFTASALVLVPTRELAMQVAEAIHRYGQKLGISVVPLYGGQ 145

Query: 425 NVREDIRQLE 454
            + + +R L+
Sbjct: 146 VISQQLRVLK 155


>UniRef50_O07897 Cluster: Heat resistant RNA dependent ATPase; n=3;
           Thermus thermophilus|Rep: Heat resistant RNA dependent
           ATPase - Thermus thermophilus
          Length = 510

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 21/51 (41%), Positives = 32/51 (62%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           F D  LK E+L  ++  G   P+ IQ  A+   ++G+D+I QA++GTGK L
Sbjct: 3   FKDFPLKPEILEALHGRGLTTPTPIQAAALPLALEGKDLIGQARTGTGKTL 53



 Score = 37.5 bits (83), Expect = 0.33
 Identities = 24/60 (40%), Positives = 35/60 (58%), Gaps = 3/60 (5%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSI---RECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 424
           KT  F++ I +++  S    R+ +AL+L PTRELA Q+   + A+  HL  K  A  GGT
Sbjct: 51  KTLAFALPIAERLAPSQERGRKPRALVLTPTRELALQVASELTAVAPHL--KVVAVYGGT 108


>UniRef50_A6TUK6 Cluster: DEAD/DEAH box helicase domain protein;
           n=2; Firmicutes|Rep: DEAD/DEAH box helicase domain
           protein - Alkaliphilus metalliredigens QYMF
          Length = 484

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 19/53 (35%), Positives = 33/53 (62%)
 Frame = +3

Query: 99  VVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +   F D  L +ELL+ I    FE P+ +QQ+ I   ++ +D+I ++Q+G+GK
Sbjct: 2   IKSNFSDYQLSDELLKSISMLNFESPTKVQQQVIPAILEHKDIIVKSQTGSGK 54



 Score = 43.2 bits (97), Expect = 0.007
 Identities = 23/55 (41%), Positives = 32/55 (58%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIG 418
           KTA F+I I Q +D    + QAL+L PTRELA Q+++ +  +G     K  A  G
Sbjct: 54  KTAAFAIPICQLVDWDENKPQALVLVPTRELAIQVKEDMFNIGRFKRLKVAAVYG 108


>UniRef50_A4M6V6 Cluster: DEAD/DEAH box helicase domain protein;
           n=2; cellular organisms|Rep: DEAD/DEAH box helicase
           domain protein - Petrotoga mobilis SJ95
          Length = 530

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 23/67 (34%), Positives = 37/67 (55%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTA F I +++++D    + QAL+L PTRELA Q+   + +L  +         GG ++ 
Sbjct: 53  KTAAFGIPLIERLDEKANDVQALVLTPTRELALQVCNEIDSLKGNKRLNLLPVYGGVSIG 112

Query: 434 EDIRQLE 454
             IR L+
Sbjct: 113 NQIRALK 119



 Score = 42.7 bits (96), Expect = 0.009
 Identities = 21/50 (42%), Positives = 31/50 (62%), Gaps = 1/50 (2%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRD-VIAQAQSGTGK 257
           F  M L + +L  I   G+E P+ IQ++ I   + G++ VI QAQ+GTGK
Sbjct: 4   FQQMGLSDNILSAIDRKGYEAPTPIQEKVIPLLLSGKNNVIGQAQTGTGK 53


>UniRef50_A2U1Q9 Cluster: ATP-dependent RNA helicase, DEAD/DEAH box
           family protein; n=4; Flavobacteriaceae|Rep:
           ATP-dependent RNA helicase, DEAD/DEAH box family protein
           - Polaribacter dokdonensis MED152
          Length = 373

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 25/69 (36%), Positives = 38/69 (55%), Gaps = 2/69 (2%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAK--CHACIGGTN 427
           KTA F + +L  ID +    QALIL+PTREL QQI+K +     +++ +    A  GG  
Sbjct: 53  KTAAFGLPVLHHIDANSDHIQALILSPTRELVQQIKKQLFKFTKYVDDRIFLEAVFGGEK 112

Query: 428 VREDIRQLE 454
           +   +  L+
Sbjct: 113 IDRQMNNLK 121


>UniRef50_Q4N4B1 Cluster: ATP-dependent RNA helicase, putative; n=4;
           Eukaryota|Rep: ATP-dependent RNA helicase, putative -
           Theileria parva
          Length = 470

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 26/66 (39%), Positives = 40/66 (60%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTA F+I ILQ++    +   +LILAPTREL+ QI++ +I+LG  +       +GG ++ 
Sbjct: 91  KTAAFTIPILQKLLEKPQRLFSLILAPTRELSLQIKEQLISLGSEIGLDVCLILGGLDMV 150

Query: 434 EDIRQL 451
               QL
Sbjct: 151 SQALQL 156



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 21/57 (36%), Positives = 34/57 (59%)
 Frame = +3

Query: 87  DWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           D D    TF+D+ +  EL R     G+++P+ IQ  AI   + G+D+I  A++G+GK
Sbjct: 35  DKDDDTPTFEDLGVCVELCRACKELGWKRPTKIQIEAIPIALSGKDIIGLAETGSGK 91


>UniRef50_Q8GUG7 Cluster: DEAD-box ATP-dependent RNA helicase 50;
           n=2; Eukaryota|Rep: DEAD-box ATP-dependent RNA helicase
           50 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 781

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 27/88 (30%), Positives = 44/88 (50%), Gaps = 4/88 (4%)
 Frame = +3

Query: 21  GHRRIKVVTMDLREWTLGHLHTDWDQVV----ETFDDMNLKEELLRGIYAYGFEKPSAIQ 188
           G RR  V T D+ +W   +   D  +      +TF ++   E++++ +    F++P+ IQ
Sbjct: 342 GDRRSVVYTRDMDDWRERNKTKDTRETGFFSRKTFAEIGCSEDMMKALKEQNFDRPAHIQ 401

Query: 189 QRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
             A  P I G+  I   QSG+GK L  L
Sbjct: 402 AMAFSPVIDGKSCIIADQSGSGKTLAYL 429


>UniRef50_Q9LYJ9 Cluster: DEAD-box ATP-dependent RNA helicase 46;
           n=16; Eukaryota|Rep: DEAD-box ATP-dependent RNA helicase
           46 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 645

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 22/52 (42%), Positives = 34/52 (65%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           +F+   L  ELLR +Y+ GF  PS IQ ++    +Q RD++A A++G+GK L
Sbjct: 162 SFEATGLPNELLREVYSAGFSAPSPIQAQSWPIAMQNRDIVAIAKTGSGKTL 213



 Score = 34.7 bits (76), Expect = 2.4
 Identities = 16/45 (35%), Positives = 23/45 (51%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           L+L+PTRELA QIQ   +  G      C    GG      ++++E
Sbjct: 237 LVLSPTRELATQIQVEALKFGKSSKISCACLYGGAPKGPQLKEIE 281


>UniRef50_Q8L4E9 Cluster: DEAD-box ATP-dependent RNA helicase 36;
           n=7; Eukaryota|Rep: DEAD-box ATP-dependent RNA helicase
           36 - Oryza sativa subsp. japonica (Rice)
          Length = 501

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 26/56 (46%), Positives = 33/56 (58%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 421
           KTA F++ IL ++        AL LAPTRELA Q+ +   ALG  L  +C A IGG
Sbjct: 127 KTAAFALPILHRLGEDPYGVAALALAPTRELAAQLAEQFRALGAPLGLRCLAAIGG 182



 Score = 41.5 bits (93), Expect = 0.021
 Identities = 19/53 (35%), Positives = 33/53 (62%)
 Frame = +3

Query: 99  VVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           V  TF ++ L + L+    + G   P+A+Q+R I   ++GRDV+  A++G+GK
Sbjct: 75  VPSTFAELGLSQWLVDVCDSLGMRVPTAVQRRCIPRALEGRDVLGIAETGSGK 127


>UniRef50_Q7S6F3 Cluster: ATP-dependent RNA helicase dbp-9; n=14;
           Fungi/Metazoa group|Rep: ATP-dependent RNA helicase
           dbp-9 - Neurospora crassa
          Length = 676

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 19/50 (38%), Positives = 34/50 (68%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           TF D+ L   L++ +    FEKP+ +Q++AI   + G+DV+ +A++G+GK
Sbjct: 96  TFSDLGLDPRLVQAVAKQSFEKPTLVQRKAIPLALAGQDVLCKAKTGSGK 145


>UniRef50_UPI0000DB7667 Cluster: PREDICTED: similar to CG32344-PA;
           n=1; Apis mellifera|Rep: PREDICTED: similar to
           CG32344-PA - Apis mellifera
          Length = 743

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 21/60 (35%), Positives = 36/60 (60%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSLYRFYNK 290
           F  M L   +L+GI   G++ P+ IQ++ I   ++GRD++A A++G+GK    L   + K
Sbjct: 38  FQSMALSFPILKGILKRGYKIPTPIQRKTIPLALEGRDIVAMARTGSGKTACFLIPLFEK 97



 Score = 38.3 bits (85), Expect = 0.19
 Identities = 23/61 (37%), Positives = 33/61 (54%), Gaps = 2/61 (3%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRE--CQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTN 427
           KTA F I + +++     +   +ALIL+PTRELA Q  K +  LG     K    +GG N
Sbjct: 86  KTACFLIPLFEKLKIRQAKVGARALILSPTRELALQTLKFIKELGRFTGLKATIILGGDN 145

Query: 428 V 430
           +
Sbjct: 146 M 146


>UniRef50_UPI0000499A01 Cluster: DEAD/DEAH box helicase; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: DEAD/DEAH box
           helicase - Entamoeba histolytica HM-1:IMSS
          Length = 684

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 21/60 (35%), Positives = 35/60 (58%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSLYRFYNK 290
           F  M L ++ L G+   G+  P+ IQ++AI   ++G D+IA A++G+GK    L    N+
Sbjct: 15  FQSMGLNKQTLLGVLKKGYRVPTPIQRKAIPAILRGNDIIAMARTGSGKTAAYLVPIINR 74



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 25/67 (37%), Positives = 37/67 (55%), Gaps = 1/67 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRE-CQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 430
           KTA + + I+ +++T   E  ++LI+ PTRELA Q  KV   LG   N K    IGG+ +
Sbjct: 63  KTAAYLVPIINRLETHSTEGVRSLIICPTRELALQTIKVFNELGKLTNLKASLIIGGSKL 122

Query: 431 REDIRQL 451
            +    L
Sbjct: 123 SDQFDNL 129


>UniRef50_UPI00004987FF Cluster: DEAD/DEAH box helicase; n=5;
           Entamoeba histolytica HM-1:IMSS|Rep: DEAD/DEAH box
           helicase - Entamoeba histolytica HM-1:IMSS
          Length = 432

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 25/71 (35%), Positives = 42/71 (59%)
 Frame = +3

Query: 105 ETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSLYRFY 284
           +TF D+ L  E+L+ +   G++KP+ IQ+ +I   +Q +D+I  AQ+G+GK       F 
Sbjct: 9   KTFKDLGLIPEVLKVVEYLGYKKPTRIQENSIPVALQKKDIIGIAQTGSGKTA----SFL 64

Query: 285 NKSIQAFVNVK 317
              +Q  +NVK
Sbjct: 65  LPMVQHLLNVK 75


>UniRef50_Q8YXJ0 Cluster: ATP-dependent RNA helicase; n=11;
           Cyanobacteria|Rep: ATP-dependent RNA helicase - Anabaena
           sp. (strain PCC 7120)
          Length = 513

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 23/67 (34%), Positives = 38/67 (56%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTA FS+ IL+++D   +  QA++L PTRELA Q+   +     +   +  A  GG ++ 
Sbjct: 53  KTAAFSLPILERLDPQQKAVQAIVLTPTRELAIQVHDAMAQFVGNSGLRTLAIYGGQSID 112

Query: 434 EDIRQLE 454
             + QL+
Sbjct: 113 RQMLQLK 119



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 19/50 (38%), Positives = 32/50 (64%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +F ++ + +E +  +   GF  P+ IQ +AI   + GRDV+ Q+Q+GTGK
Sbjct: 4   SFPELGISQERVEHLEKLGFTAPTNIQAQAIPQLLSGRDVVGQSQTGTGK 53


>UniRef50_A5G1U8 Cluster: DEAD/DEAH box helicase domain protein;
           n=1; Acidiphilium cryptum JF-5|Rep: DEAD/DEAH box
           helicase domain protein - Acidiphilium cryptum (strain
           JF-5)
          Length = 525

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 23/57 (40%), Positives = 33/57 (57%)
 Frame = +3

Query: 87  DWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           D   V+  F  + L E LLR I    +E P+ IQ R+I   ++G D++  AQ+GTGK
Sbjct: 51  DESAVLTDFTTLGLAEPLLRAISEQSYETPTPIQARSIPVMLEGHDLVGIAQTGTGK 107



 Score = 42.3 bits (95), Expect = 0.012
 Identities = 27/72 (37%), Positives = 34/72 (47%), Gaps = 5/72 (6%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSI-----RECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIG 418
           KTA F + IL +I  +      R C+AL+LAPTRELA QI       G          IG
Sbjct: 107 KTAAFVLPILHRIAANRARPAPRACRALVLAPTRELATQIADAARTYGKFTRPSVAVVIG 166

Query: 419 GTNVREDIRQLE 454
           G       R++E
Sbjct: 167 GAKPGPQARRME 178


>UniRef50_A4RYJ1 Cluster: Predicted protein; n=3; Ostreococcus|Rep:
           Predicted protein - Ostreococcus lucimarinus CCE9901
          Length = 407

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 24/52 (46%), Positives = 32/52 (61%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           +F D+ L E L R + A GF+ PS +Q   +     G DVIAQA+SGTGK +
Sbjct: 38  SFGDLQLDERLTRALRAAGFDAPSPVQLACVPLGRFGCDVIAQAKSGTGKTM 89



 Score = 38.3 bits (85), Expect = 0.19
 Identities = 18/42 (42%), Positives = 25/42 (59%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIAL 379
           KT TF +  L+++D   R  QAL LAPTRE A Q  +  + +
Sbjct: 87  KTMTFVVIALERVDAGRRRTQALALAPTRECAVQTHECFVEM 128


>UniRef50_Q7QQX6 Cluster: GLP_383_7421_6129; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_383_7421_6129 - Giardia lamblia ATCC
           50803
          Length = 430

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 21/49 (42%), Positives = 34/49 (69%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F  + LK+ELL G+   GF++ + +Q+ AI   +  RDV+A+A++GTGK
Sbjct: 23  FSSLGLKQELLMGLTQEGFQQLTPVQELAIPHILARRDVVARAKNGTGK 71



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 25/65 (38%), Positives = 35/65 (53%), Gaps = 3/65 (4%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL---NAKCHACIGGT 424
           KT +F I ILQ ++ +    QAL+L  TRELA Q  KV   L  ++     +    IGG 
Sbjct: 71  KTGSFLIPILQMVNPAKDHIQALVLLHTRELAMQTAKVAKTLSKNMPDVTGRIMCAIGGV 130

Query: 425 NVRED 439
           ++ ED
Sbjct: 131 SIAED 135


>UniRef50_Q49K88 Cluster: DEAD box RNA helicase; n=1; Toxoplasma
           gondii|Rep: DEAD box RNA helicase - Toxoplasma gondii
          Length = 479

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 24/56 (42%), Positives = 33/56 (58%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 421
           KTA F + ILQ++    +   ALILAPTREL  QI + ++A+G  L       +GG
Sbjct: 101 KTAAFGLPILQRLLQRTQRFYALILAPTRELCLQISQQILAMGGTLGVTVVTLVGG 156



 Score = 46.0 bits (104), Expect = 0.001
 Identities = 21/53 (39%), Positives = 32/53 (60%)
 Frame = +3

Query: 99  VVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           V  TF  + L  EL   +   G++ P+AIQ   +   +QGRD+IA A++G+GK
Sbjct: 49  VSPTFASLGLCSELCASVSTLGWKSPTAIQSEVLPYALQGRDIIALAETGSGK 101


>UniRef50_A7SE71 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 411

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 26/80 (32%), Positives = 44/80 (55%), Gaps = 2/80 (2%)
 Frame = +3

Query: 30  RIKVVTMDLREWTLG-HLH-TDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIM 203
           R+    +D   W  G H+   D  + +E+F D+NL  EL   +    F+ P+ IQ +++ 
Sbjct: 13  RLSDEVVDEIRWKNGIHIEGEDCPKPIESFHDLNLPPELSTYLAKKNFQVPTPIQMQSLS 72

Query: 204 PCIQGRDVIAQAQSGTGKLL 263
             + GRD+I  A++G+GK L
Sbjct: 73  CVMSGRDIIGLAETGSGKTL 92


>UniRef50_Q5BF42 Cluster: Putative uncharacterized protein; n=1;
           Emericella nidulans|Rep: Putative uncharacterized
           protein - Emericella nidulans (Aspergillus nidulans)
          Length = 1676

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 19/50 (38%), Positives = 31/50 (62%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +F + NL   +LRG+ A  F  P+ IQQ+ I   + G+D++  A +G+GK
Sbjct: 791 SFQEFNLSRPILRGLAAVNFTNPTPIQQKTIPVALLGKDIVGSAVTGSGK 840



 Score = 34.7 bits (76), Expect = 2.4
 Identities = 21/64 (32%), Positives = 32/64 (50%), Gaps = 3/64 (4%)
 Frame = +2

Query: 254  KTATFSISILQQI---DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 424
            KTA F + IL+++      +   +  IL PTRELA Q   V   L  + +      +GG 
Sbjct: 840  KTAAFVVPILERLLFRPRKVPTSRVAILMPTRELAVQCYNVATKLATYTDITFCQLVGGF 899

Query: 425  NVRE 436
            ++RE
Sbjct: 900  SLRE 903


>UniRef50_Q9P9G7 Cluster: DEAD-box RNA helicase; n=3;
           Methanosarcinaceae|Rep: DEAD-box RNA helicase -
           Methanococcoides burtonii
          Length = 522

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 25/67 (37%), Positives = 35/67 (52%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KT  F   I+Q+I+      +AL+L PTRELA+Q+Q  +     H   +     GG  + 
Sbjct: 52  KTLAFGCGIIQKIEKG-NGIRALVLTPTRELAEQVQNSLKEFSRHKQLRVAPIYGGVAIN 110

Query: 434 EDIRQLE 454
             IRQLE
Sbjct: 111 PQIRQLE 117



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 20/54 (37%), Positives = 36/54 (66%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           +E+F  + +++ +LR I    FE+P+ IQ+ AI   ++G+D+I  A +G+GK L
Sbjct: 1   MESFKKLGIEDAILRSIEDKKFEEPTEIQKMAIPLILEGKDIIGGAATGSGKTL 54


>UniRef50_Q4P3U9 Cluster: ATP-dependent rRNA helicase RRP3; n=20;
           Eukaryota|Rep: ATP-dependent rRNA helicase RRP3 -
           Ustilago maydis (Smut fungus)
          Length = 551

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 25/59 (42%), Positives = 36/59 (61%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 430
           KTA F+I ILQ +  + +   A +LAPTRELA QI + V ALG  +  +    +GG ++
Sbjct: 154 KTAAFTIPILQALWDNPKPFFACVLAPTRELAYQISQQVEALGSTIGVRSATIVGGMDM 212



 Score = 42.3 bits (95), Expect = 0.012
 Identities = 19/49 (38%), Positives = 30/49 (61%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D+ +  +++      GF+ P+ IQ +AI   +Q RDVI  AQ+G+GK
Sbjct: 106 FSDLGVIPQIVEACTNMGFKHPTPIQVKAIPEALQARDVIGLAQTGSGK 154


>UniRef50_A5DIX5 Cluster: ATP-dependent RNA helicase ROK1; n=2;
           Pichia guilliermondii|Rep: ATP-dependent RNA helicase
           ROK1 - Pichia guilliermondii (Yeast) (Candida
           guilliermondii)
          Length = 537

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 27/67 (40%), Positives = 40/67 (59%), Gaps = 4/67 (5%)
 Frame = +3

Query: 84  TDWDQVVETFDDM----NLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGT 251
           TD    + +F+D+    NL  +LL  + A G+ +P+AIQ  AI    +GRD+IA A +G+
Sbjct: 95  TDIPLPIGSFEDLIARCNLNRKLLANLIASGYSEPTAIQCEAIPASAEGRDLIACAPTGS 154

Query: 252 GKLLLSL 272
           GK L  L
Sbjct: 155 GKTLAYL 161


>UniRef50_P0C2N7 Cluster: ATP-dependent RNA helicase DRS1; n=2;
           Chaetomium globosum|Rep: ATP-dependent RNA helicase DRS1
           - Chaetomium globosum (Soil fungus)
          Length = 795

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 20/52 (38%), Positives = 33/52 (63%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           + +F  M+L   +LRG+ + GF KP+ IQ + I   + G+DV+  A +G+GK
Sbjct: 275 LSSFQGMSLSRPILRGLTSVGFTKPTPIQAKTIPIALMGKDVVGGAVTGSGK 326



 Score = 38.3 bits (85), Expect = 0.19
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 3/63 (4%)
 Frame = +2

Query: 254 KTATFSISILQQI---DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 424
           KTA F + IL+++      +   + ++L PTRELA Q   V   L  H + K    +GG 
Sbjct: 326 KTAAFVVPILERLLYRPKKVPTTRVVVLTPTRELAIQCHSVATKLASHTDIKFCLAVGGL 385

Query: 425 NVR 433
           +++
Sbjct: 386 SLK 388


>UniRef50_Q4S1T3 Cluster: Chromosome undetermined SCAF14764, whole
           genome shotgun sequence; n=1; Tetraodon
           nigroviridis|Rep: Chromosome undetermined SCAF14764,
           whole genome shotgun sequence - Tetraodon nigroviridis
           (Green puffer)
          Length = 447

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 18/49 (36%), Positives = 36/49 (73%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F +M L + LL+ +   G+ +P+ IQ++AI   ++G+D++A+A++G+GK
Sbjct: 8   FHEMGLDDRLLKAVADLGWSQPTLIQEKAIPLALEGKDLLARARTGSGK 56



 Score = 37.1 bits (82), Expect = 0.44
 Identities = 19/44 (43%), Positives = 31/44 (70%), Gaps = 5/44 (11%)
 Frame = +2

Query: 254 KTATFSISILQQI---DTSIRE--CQALILAPTRELAQQIQKVV 370
           KTA +++ ++Q+I     S+RE   +ALIL PT+EL QQ+Q ++
Sbjct: 56  KTAAYAVPVIQRILASKQSVREQDVKALILVPTKELGQQVQTMI 99


>UniRef50_Q9KLE2 Cluster: ATP-dependent RNA helicase DeaD; n=35;
           Vibrionales|Rep: ATP-dependent RNA helicase DeaD -
           Vibrio cholerae
          Length = 663

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 24/68 (35%), Positives = 42/68 (61%), Gaps = 1/68 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNA-KCHACIGGTNV 430
           KTA FS+ +L +++ S  + QA+++APTRELA Q+   +  LG ++   K     GG ++
Sbjct: 76  KTAAFSLPLLNKLNLSQYKPQAIVMAPTRELAIQVAAEIKNLGQNIKGLKVLEIYGGASI 135

Query: 431 REDIRQLE 454
            + +R L+
Sbjct: 136 LDQMRALK 143



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 20/49 (40%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D+ L   +L  +   GF  P+ IQ  AI   ++GRD + +AQ+GTGK
Sbjct: 28  FSDLALNSAILSALTEMGFVSPTPIQAAAIPVLLEGRDALGKAQTGTGK 76


>UniRef50_Q4FSS4 Cluster: Possible ATP-dependent DEAD/DEAH box
           RNA-helicase; n=4; Gammaproteobacteria|Rep: Possible
           ATP-dependent DEAD/DEAH box RNA-helicase - Psychrobacter
           arcticum
          Length = 567

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 21/55 (38%), Positives = 34/55 (61%)
 Frame = +3

Query: 93  DQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           D+   TF D+N+ + +L  +   G+  P+ IQ  AI   +QGRD++  AQ+G+GK
Sbjct: 40  DENKVTFTDLNIAKPILSALERSGYTHPTPIQAEAIPFALQGRDLLLSAQTGSGK 94



 Score = 36.3 bits (80), Expect = 0.77
 Identities = 28/78 (35%), Positives = 38/78 (48%), Gaps = 4/78 (5%)
 Frame = +2

Query: 233 SSPVRNWKTATFSISILQQID--TSIREC-QALILAPTRELAQQIQKVVIALG-DHLNAK 400
           S+   + KTA F I +L ++   TS  +  +ALIL PTRELAQQ+   V     D     
Sbjct: 87  SAQTGSGKTAAFVIPVLDRLSRATSFDKLTKALILTPTRELAQQVHDSVRTYSKDMRGLF 146

Query: 401 CHACIGGTNVREDIRQLE 454
           C   +GG      I  L+
Sbjct: 147 CVPLVGGAPYNGQITALK 164


>UniRef50_Q11WD3 Cluster: Possible ATP-dependent RNA helicase; n=4;
           Sphingobacteriales|Rep: Possible ATP-dependent RNA
           helicase - Cytophaga hutchinsonii (strain ATCC 33406 /
           NCIMB 9469)
          Length = 463

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 20/49 (40%), Positives = 31/49 (63%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F+++ L  +LL  I   G+ +P+ IQ +AI   + G D+I  AQ+GTGK
Sbjct: 7   FEELKLNRQLLNAIEEAGYTEPTEIQSKAIPQILAGHDIIGVAQTGTGK 55


>UniRef50_Q11UP8 Cluster: ATP-dependent RNA helicase; n=1; Cytophaga
           hutchinsonii ATCC 33406|Rep: ATP-dependent RNA helicase
           - Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB
           9469)
          Length = 580

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 26/68 (38%), Positives = 37/68 (54%), Gaps = 1/68 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNA-KCHACIGGTNV 430
           KTA F I  ++ +D SI + Q+LIL PTRELA Q+   +  L       +  A  GG ++
Sbjct: 51  KTAAFGIPAIEHVDISINQTQSLILCPTRELALQVCTELKKLSKFKKGLRVLAVYGGESI 110

Query: 431 REDIRQLE 454
              IR L+
Sbjct: 111 ERQIRDLK 118



 Score = 42.7 bits (96), Expect = 0.009
 Identities = 18/49 (36%), Positives = 31/49 (63%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D+ L  E++  I + G+ + + IQ++ I   + G+D+  QAQ+GTGK
Sbjct: 3   FKDLGLSPEVVEAIESIGYSEATPIQEKTIPILMTGKDLTGQAQTGTGK 51


>UniRef50_Q9LKL6 Cluster: DEAD box protein P68; n=5;
           Viridiplantae|Rep: DEAD box protein P68 - Pisum sativum
           (Garden pea)
          Length = 622

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 32/72 (44%), Positives = 42/72 (58%), Gaps = 6/72 (8%)
 Frame = +2

Query: 254 KTATFSISILQQ--IDTSIRECQ---ALILAPTRELAQQIQKVVIALGDHLNA-KCHACI 415
           KTA F+I +LQ   +   IR      AL+LAPTRELAQQI+K V A    L + K    +
Sbjct: 168 KTAAFTIPMLQHCLVQPPIRRGDGPLALVLAPTRELAQQIEKEVQAFSRSLESLKNCIVV 227

Query: 416 GGTNVREDIRQL 451
           GGTN+ +   +L
Sbjct: 228 GGTNIEKQRSEL 239



 Score = 46.0 bits (104), Expect = 0.001
 Identities = 24/85 (28%), Positives = 49/85 (57%)
 Frame = +3

Query: 3   QRIPKMGHRRIKVVTMDLREWTLGHLHTDWDQVVETFDDMNLKEELLRGIYAYGFEKPSA 182
           +R+ +M   +I+ V     + T+    T     +E+F+DM L   +++ I  + + +PS+
Sbjct: 84  ERVSRMNPDQIEEVVRLNLDVTVSSDSTAAPGPIESFNDMCLHPSIMKDIAYHEYTRPSS 143

Query: 183 IQQRAIMPCIQGRDVIAQAQSGTGK 257
           IQ +A+   + GRD++  A++G+GK
Sbjct: 144 IQAQAMPIALSGRDLLGCAETGSGK 168


>UniRef50_Q2LZJ8 Cluster: GA19670-PA; n=1; Drosophila
           pseudoobscura|Rep: GA19670-PA - Drosophila pseudoobscura
           (Fruit fly)
          Length = 1007

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 20/52 (38%), Positives = 34/52 (65%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLL 266
           F  ++L+ +++RG+ A  F  P+ IQ  AI   + G D++ Q++SGTGK L+
Sbjct: 27  FSALHLRRQVMRGLAAENFRTPTKIQAAAIPIALTGMDLLVQSKSGTGKTLI 78



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 23/67 (34%), Positives = 38/67 (56%), Gaps = 1/67 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNA-KCHACIGGTNV 430
           KT  + ++ LQ    S +  + L++ PTRELA Q+  +   LG+ L + K  + +GGT+V
Sbjct: 75  KTLIYVVTALQMCSLSTQHPEVLVILPTRELALQVHDIFRFLGEKLRSFKVSSFMGGTDV 134

Query: 431 REDIRQL 451
             D  +L
Sbjct: 135 TRDREKL 141


>UniRef50_Q238V7 Cluster: Type III restriction enzyme, res subunit
           family protein; n=1; Tetrahymena thermophila SB210|Rep:
           Type III restriction enzyme, res subunit family protein
           - Tetrahymena thermophila SB210
          Length = 1130

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 22/60 (36%), Positives = 36/60 (60%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSLYRFYNK 290
           F+ MNL   + + I   GF  P+ IQ++AI   ++GRDV+A +++G+GK    +    NK
Sbjct: 301 FESMNLVYPVYKAIKTRGFNMPTPIQRKAIPLILEGRDVVACSRTGSGKTAAFIIPLINK 360


>UniRef50_Q17BP5 Cluster: DEAD box ATP-dependent RNA helicase; n=2;
           Culicidae|Rep: DEAD box ATP-dependent RNA helicase -
           Aedes aegypti (Yellowfever mosquito)
          Length = 1061

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 25/52 (48%), Positives = 31/52 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLL 266
           F  M L E +LRG+    F  PS IQ RAI     G D++ QA+SGTGK L+
Sbjct: 24  FSKMFLSEPVLRGLTRNNFTHPSPIQARAIPLAKLGLDLLVQAKSGTGKTLV 75



 Score = 40.7 bits (91), Expect = 0.036
 Identities = 21/68 (30%), Positives = 40/68 (58%), Gaps = 1/68 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KT  F++ I +  +  +   Q+L + PTRE+A QI+ V+  +G  + N +  + IGG ++
Sbjct: 72  KTLVFTVLITENHNPDVMFPQSLTVVPTREIAVQIEDVLNRIGYSVPNFRAKSFIGGLDI 131

Query: 431 REDIRQLE 454
            +D + L+
Sbjct: 132 SQDRKNLQ 139


>UniRef50_A0BDD2 Cluster: Chromosome undetermined scaffold_100,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_100,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 737

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 23/53 (43%), Positives = 37/53 (69%), Gaps = 1/53 (1%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCI-QGRDVIAQAQSGTGKLL 263
           +F  + L ++L+  I A  FEKP+AIQ +A +PC+  GR+VI  A++G+GK +
Sbjct: 189 SFGHLQLDQKLVNKIVAQNFEKPTAIQSQA-LPCVLSGRNVIGVAKTGSGKTI 240


>UniRef50_Q5KLJ5 Cluster: Translation initiation factor, putative;
           n=2; Filobasidiella neoformans|Rep: Translation
           initiation factor, putative - Cryptococcus neoformans
           (Filobasidiella neoformans)
          Length = 932

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 23/55 (41%), Positives = 34/55 (61%)
 Frame = +3

Query: 99  VVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           VV  ++ +NLK +LLR I  YG   P+ IQ R +   I+G D+IAQA   T +++
Sbjct: 342 VVSKWEHLNLKVDLLRSISKYGIGPPNKIQTRVLPFMIKGSDIIAQAPPTTERII 396


>UniRef50_Q11039 Cluster: Cold-shock DEAD box protein A homolog;
           n=31; Bacteria|Rep: Cold-shock DEAD box protein A
           homolog - Mycobacterium tuberculosis
          Length = 563

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 22/50 (44%), Positives = 30/50 (60%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           TF D+ +   +LR I   G+E P+AIQ   I   + G DV+  AQ+GTGK
Sbjct: 14  TFADLQIHPRVLRAIGDVGYESPTAIQAATIPALMAGSDVVGLAQTGTGK 63



 Score = 42.3 bits (95), Expect = 0.012
 Identities = 21/47 (44%), Positives = 31/47 (65%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLN 394
           KTA F+I +L +ID + +  QAL+L PTRELA Q+ +     G +L+
Sbjct: 63  KTAAFAIPMLSKIDITSKVPQALVLVPTRELALQVAEAFGRYGAYLS 109


>UniRef50_UPI00015BD198 Cluster: UPI00015BD198 related cluster; n=1;
           unknown|Rep: UPI00015BD198 UniRef100 entry - unknown
          Length = 364

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 21/67 (31%), Positives = 41/67 (61%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KT  F+I I++++     + +AL+L PTRELA Q+++ +  L  +     +   GGT+V+
Sbjct: 50  KTGAFAIPIVEKLQKGKPDVKALVLTPTRELAIQVKEQIYMLTKYKRLSSYVFYGGTSVK 109

Query: 434 EDIRQLE 454
           +++  L+
Sbjct: 110 QNLDILQ 116


>UniRef50_UPI0000498CE0 Cluster: DEAD/DEAH box helicase; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: DEAD/DEAH box
           helicase - Entamoeba histolytica HM-1:IMSS
          Length = 440

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 24/64 (37%), Positives = 39/64 (60%), Gaps = 3/64 (4%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK---LLLSLYR 278
           +F +  L E++L GI   G+  PS IQ  AI   ++G++++ Q+QSG+GK    LLS  +
Sbjct: 26  SFQECKLNEDILDGINGMGYITPSQIQSYAIPIILKGKNLVMQSQSGSGKTMAFLLSTLQ 85

Query: 279 FYNK 290
             N+
Sbjct: 86  LINR 89



 Score = 32.7 bits (71), Expect = 9.5
 Identities = 16/38 (42%), Positives = 22/38 (57%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKV 367
           KT  F +S LQ I+     CQ +I+  TRELA+Q   +
Sbjct: 75  KTMAFLLSTLQLINRKDPFCQVIIIVNTRELARQTASI 112


>UniRef50_Q8D6Y8 Cluster: Superfamily II DNA and RNA helicase; n=32;
           Gammaproteobacteria|Rep: Superfamily II DNA and RNA
           helicase - Vibrio vulnificus
          Length = 427

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 28/72 (38%), Positives = 38/72 (52%), Gaps = 5/72 (6%)
 Frame = +2

Query: 254 KTATFSISILQQI-----DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIG 418
           KTA FS+ ++QQ+       S +  +ALI APTRELA+QI   + A   + N    A  G
Sbjct: 51  KTAAFSLPLIQQLLESGKSASRKTARALIFAPTRELAEQIADNIKAYTKYTNLSVAAIFG 110

Query: 419 GTNVREDIRQLE 454
           G  +    R LE
Sbjct: 111 GRKMSSQERMLE 122



 Score = 41.5 bits (93), Expect = 0.021
 Identities = 19/50 (38%), Positives = 30/50 (60%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +F       E+++ +   G+EK + IQQ+AI    +G D+ A AQ+GTGK
Sbjct: 2   SFASQGFAPEVVKALEECGYEKLTPIQQKAIPVARRGHDIFATAQTGTGK 51


>UniRef50_Q88XN5 Cluster: ATP-dependent RNA helicase; n=2;
           Lactobacillus|Rep: ATP-dependent RNA helicase -
           Lactobacillus plantarum
          Length = 444

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 27/73 (36%), Positives = 41/73 (56%)
 Frame = +2

Query: 236 SPVRNWKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI 415
           +P  + KT  F+  +L+ +       QALILAP++ELA Q   VV   G  ++AK  A  
Sbjct: 38  APTGSGKTLAFTWPMLEALRVG-EGTQALILAPSQELAMQTTNVVREWGQLIDAKVLAIT 96

Query: 416 GGTNVREDIRQLE 454
           GG NV+  + +L+
Sbjct: 97  GGANVKRQMEKLK 109


>UniRef50_Q6MBR0 Cluster: Putative ATP-dependent RNA helicase; n=1;
           Candidatus Protochlamydia amoebophila UWE25|Rep:
           Putative ATP-dependent RNA helicase - Protochlamydia
           amoebophila (strain UWE25)
          Length = 407

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 23/56 (41%), Positives = 32/56 (57%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 421
           KTAT +I I  +++T + + QALI+ PTRELA Q       +G +   K  A  GG
Sbjct: 65  KTATCAIPICNRVNTELTDIQALIIVPTRELALQYATETQKIGKYKGVKAFAIFGG 120



 Score = 35.1 bits (77), Expect = 1.8
 Identities = 21/50 (42%), Positives = 31/50 (62%), Gaps = 1/50 (2%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGR-DVIAQAQSGTGK 257
           F   NL   +L+ +    F++PS IQ  AI P IQ + D+IA +Q+G+GK
Sbjct: 17  FITFNLDPLILKALDKMNFKEPSRIQTEAI-PLIQKKQDLIALSQTGSGK 65


>UniRef50_Q62J95 Cluster: ATP-dependent RNA helicase RhlE, putative;
           n=58; Proteobacteria|Rep: ATP-dependent RNA helicase
           RhlE, putative - Burkholderia mallei (Pseudomonas
           mallei)
          Length = 516

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 20/50 (40%), Positives = 32/50 (64%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           TF  + L  E++  + A G+ KP+ +QQRAI   I GRD++  + +G+GK
Sbjct: 44  TFASLGLSPEIVSALQAAGYVKPTPVQQRAIPAGIAGRDLLVSSPTGSGK 93


>UniRef50_Q2YZZ9 Cluster: Putative uncharacterized protein; n=1;
           uncultured candidate division OP8 bacterium|Rep:
           Putative uncharacterized protein - uncultured candidate
           division OP8 bacterium
          Length = 453

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 21/49 (42%), Positives = 31/49 (63%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F  ++L   LL+ +   GF +P+ IQ  AI P + GRDV+A A +G+GK
Sbjct: 3   FSSLHLHPTLLKALKELGFPRPTPIQADAIPPAMSGRDVMASAVTGSGK 51



 Score = 41.5 bits (93), Expect = 0.021
 Identities = 25/61 (40%), Positives = 33/61 (54%), Gaps = 1/61 (1%)
 Frame = +2

Query: 254 KTATFSISILQQ-IDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 430
           KTA F + IL Q ID      +AL++ PTRELA QI + +  L  H      A  GG ++
Sbjct: 51  KTAAFLLPILHQLIDRPRGTTRALVITPTRELAAQILEDLNDLAVHTPISAAAVFGGVSI 110

Query: 431 R 433
           R
Sbjct: 111 R 111


>UniRef50_A5FH33 Cluster: DEAD/DEAH box helicase domain protein;
           n=7; Flavobacteria|Rep: DEAD/DEAH box helicase domain
           protein - Flavobacterium johnsoniae UW101
          Length = 450

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 24/66 (36%), Positives = 38/66 (57%), Gaps = 6/66 (9%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKL------L 263
           + TF+  NL + L + +   GF  P+ IQ+++    + GRD++  AQ+GTGK       L
Sbjct: 1   MSTFEKFNLPKSLQKAVDELGFVTPTPIQEKSFSVIMSGRDMMGIAQTGTGKTFAYLLPL 60

Query: 264 LSLYRF 281
           L LY+F
Sbjct: 61  LKLYKF 66


>UniRef50_A1KUM8 Cluster: Putative ATP-dependent RNA helicase; n=4;
           Neisseria|Rep: Putative ATP-dependent RNA helicase -
           Neisseria meningitidis serogroup C / serotype 2a (strain
           ATCC 700532 /FAM18)
          Length = 483

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 21/49 (42%), Positives = 30/49 (61%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F  + L  EL+  + A G+E P+ IQ  AI   + G D++A AQ+GTGK
Sbjct: 31  FSSLGLGTELVSALTAQGYENPTPIQAAAIPKALAGHDLLAAAQTGTGK 79


>UniRef50_A0M3C7 Cluster: RhlE-like DEAD box family ATP-dependent
           RNA helicase; n=4; Bacteroidetes|Rep: RhlE-like DEAD box
           family ATP-dependent RNA helicase - Gramella forsetii
           (strain KT0803)
          Length = 455

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 26/67 (38%), Positives = 36/67 (53%), Gaps = 3/67 (4%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK---LLLSLYR 278
           +F D+NL   L   +    F+ P+ IQ++A    + GRDV+  AQ+GTGK    LL L R
Sbjct: 10  SFQDLNLNTPLRNALEDLNFQTPTPIQEQAFSSIMSGRDVVGIAQTGTGKTFAYLLPLLR 69

Query: 279 FYNKSIQ 299
               S Q
Sbjct: 70  MLKYSEQ 76



 Score = 33.9 bits (74), Expect = 4.1
 Identities = 18/67 (26%), Positives = 35/67 (52%), Gaps = 1/67 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIREC-QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 430
           KT  + + +L+ +  S ++  + LI+ PTREL  Q+ + +  L  ++N +     GG N+
Sbjct: 59  KTFAYLLPLLRMLKYSEQKNPRILIMVPTRELVVQVVEEIEKLAKYINLRVAGVYGGVNI 118

Query: 431 REDIRQL 451
               + L
Sbjct: 119 NTQHQDL 125


>UniRef50_Q3LWE1 Cluster: Translation initiation factor 4A2; n=1;
           Bigelowiella natans|Rep: Translation initiation factor
           4A2 - Bigelowiella natans (Pedinomonas minutissima)
           (Chlorarachnion sp.(strain CCMP 621))
          Length = 378

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 27/73 (36%), Positives = 37/73 (50%)
 Frame = +2

Query: 236 SPVRNWKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI 415
           SP    KT  + I    Q+  SI   Q LIL PTREL+ QI+ V   L  +      +C 
Sbjct: 54  SPSGTGKTTCYIIGTSNQLCQSINSPQCLILVPTRELSIQIRNVFNVLNIYTKNSITSCH 113

Query: 416 GGTNVREDIRQLE 454
           GG  + ED++ L+
Sbjct: 114 GGRWLGEDLKNLK 126



 Score = 46.0 bits (104), Expect = 0.001
 Identities = 20/52 (38%), Positives = 33/52 (63%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           V++F D+ LK  + +G++       S IQ   ++P ++GRD+I Q+ SGTGK
Sbjct: 9   VKSFFDLKLKNSIKKGVFINAMYYCSKIQSITLIPLLKGRDIIYQSPSGTGK 60


>UniRef50_Q5CIF9 Cluster: DEAD-box RNA helicase; n=2;
           Cryptosporidium|Rep: DEAD-box RNA helicase -
           Cryptosporidium hominis
          Length = 518

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 23/43 (53%), Positives = 31/43 (72%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALG 382
           KTATF++++L ++DT I   Q + L PTRELA+Q Q VV  LG
Sbjct: 163 KTATFALAMLGKVDTRIIHPQCMCLCPTRELARQNQDVVNELG 205



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 22/50 (44%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQG-RDVIAQAQSGTGK 257
           + D+NL  +LL+GIY  GF +PS IQ  A+   +    ++IAQA +G+GK
Sbjct: 114 WSDLNLSPDLLKGIYNKGFNRPSKIQAAALPLILNSPMNLIAQAHNGSGK 163


>UniRef50_Q4N9Q9 Cluster: DEAD box RNA helicase, putative; n=3;
           Piroplasmida|Rep: DEAD box RNA helicase, putative -
           Theileria parva
          Length = 501

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 21/50 (42%), Positives = 33/50 (66%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKC 403
           KTATF++++L +++ ++   QAL + PTRELA Q  +V+  LG     KC
Sbjct: 150 KTATFALAMLSKVNVNVPLVQALCICPTRELATQNVQVIQKLGQFTQIKC 199



 Score = 42.3 bits (95), Expect = 0.012
 Identities = 24/51 (47%), Positives = 34/51 (66%), Gaps = 2/51 (3%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQG--RDVIAQAQSGTGK 257
           +  + L  +LL+GI   GF KPS IQQ A +P I G   ++IAQA++G+GK
Sbjct: 101 WSQLPLSPDLLKGIQNMGFAKPSKIQQCA-LPLILGSCTNIIAQAKNGSGK 150


>UniRef50_Q3ZDP1 Cluster: Vasa-like protein; n=7; Neoptera|Rep:
           Vasa-like protein - Anopheles gambiae (African malaria
           mosquito)
          Length = 596

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 21/52 (40%), Positives = 35/52 (67%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           VE+F+   L+EE++  +    + KP+ IQ+ AI   + GRD++A AQ+G+GK
Sbjct: 173 VESFERSGLREEVMTNVRKSSYTKPTPIQRYAIPIILNGRDLMACAQTGSGK 224


>UniRef50_Q17JB5 Cluster: DEAD box ATP-dependent RNA helicase; n=4;
           Eukaryota|Rep: DEAD box ATP-dependent RNA helicase -
           Aedes aegypti (Yellowfever mosquito)
          Length = 699

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 24/46 (52%), Positives = 27/46 (58%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           AL+LAPTRELAQQIQ+V    G  +NA      GG      IR LE
Sbjct: 198 ALVLAPTRELAQQIQQVATDFGQRINANNTCVFGGAPKGPQIRDLE 243



 Score = 41.1 bits (92), Expect = 0.027
 Identities = 19/51 (37%), Positives = 30/51 (58%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           F+   L + +L      GF KP+AIQ + +   + GRD++  AQ+G+GK L
Sbjct: 124 FEQGGLPDYILEEANKQGFSKPTAIQAQGMPIALSGRDMVGIAQTGSGKTL 174


>UniRef50_Q4P1Z0 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 1220

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 22/47 (46%), Positives = 31/47 (65%)
 Frame = +3

Query: 99  VVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQA 239
           VV  ++ +NL  +LLR I  YG   P+ IQQRA+   ++G D+IAQA
Sbjct: 644 VVSKWEHLNLHPDLLRSILKYGLGPPNKIQQRALPFLLRGSDIIAQA 690


>UniRef50_A4RIF1 Cluster: ATP-dependent RNA helicase DBP5; n=7;
           Ascomycota|Rep: ATP-dependent RNA helicase DBP5 -
           Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 504

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 22/54 (40%), Positives = 36/54 (66%), Gaps = 2/54 (3%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQG--RDVIAQAQSGTGK 257
           + +F ++ L + ++ G+ A  F+KPS IQ RA+   +    R++IAQ+QSGTGK
Sbjct: 95  ISSFSELGLPQGIIDGLLAMNFKKPSKIQARALPLMLSNPPRNMIAQSQSGTGK 148



 Score = 42.3 bits (95), Expect = 0.012
 Identities = 21/44 (47%), Positives = 31/44 (70%), Gaps = 1/44 (2%)
 Frame = +2

Query: 254 KTATFSISILQQID-TSIRECQALILAPTRELAQQIQKVVIALG 382
           KT  F ++IL ++D     + QAL LAP+RELA+QIQ V+ ++G
Sbjct: 148 KTGAFVVTILSRVDFNQPNQPQALALAPSRELARQIQSVIQSIG 191


>UniRef50_Q9VHP0 Cluster: ATP-dependent RNA helicase bel; n=4;
           Protostomia|Rep: ATP-dependent RNA helicase bel -
           Drosophila melanogaster (Fruit fly)
          Length = 798

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 22/63 (34%), Positives = 37/63 (58%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSLYRF 281
           + +FDD+ L E +   +    ++KP+ +Q+ AI   I GRD++A AQ+G+GK    L   
Sbjct: 294 ITSFDDVQLTEIIRNNVALARYDKPTPVQKHAIPIIINGRDLMACAQTGSGKTAAFLVPI 353

Query: 282 YNK 290
            N+
Sbjct: 354 LNQ 356


>UniRef50_Q502G7 Cluster: LOC553462 protein; n=3; Danio rerio|Rep:
           LOC553462 protein - Danio rerio (Zebrafish) (Brachydanio
           rerio)
          Length = 310

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 23/70 (32%), Positives = 38/70 (54%), Gaps = 1/70 (1%)
 Frame = +3

Query: 57  REWTLGHLHTDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGR-DVIA 233
           R W+   L       V ++ D+ + E +LR +   GF  P+AIQ   + P I+ R D++ 
Sbjct: 201 RHWSRASLEAPGPADVSSWRDLLVPEPVLRALAVLGFSAPTAIQALVLPPAIRDRLDILG 260

Query: 234 QAQSGTGKLL 263
            A++G+GK L
Sbjct: 261 AAETGSGKTL 270


>UniRef50_Q8A2K2 Cluster: ATP-dependent RNA helicase; n=10; cellular
           organisms|Rep: ATP-dependent RNA helicase - Bacteroides
           thetaiotaomicron
          Length = 647

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNA-KCHACIGGTNV 430
           KTA F + +LQQID   R  Q+LIL PTREL  QI   +     +++  K     GG+++
Sbjct: 53  KTAAFGLPLLQQIDVKNRVPQSLILCPTRELCLQIAGDLNDYSKYIDGLKVLPVYGGSSI 112

Query: 431 REDIRQLE 454
              IR L+
Sbjct: 113 DSQIRSLK 120



 Score = 41.5 bits (93), Expect = 0.021
 Identities = 18/53 (33%), Positives = 33/53 (62%), Gaps = 1/53 (1%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCI-QGRDVIAQAQSGTGK 257
           ++TF+++ +  E+ + I   G+E P  +Q+  I   + +  DV+A AQ+GTGK
Sbjct: 1   MKTFEELGVSPEIRKAIEEMGYENPMPVQEEVIPYLLGENNDVVALAQTGTGK 53


>UniRef50_Q82T78 Cluster: RhlE; ATP-dependent RNA helicase RhlE;
           n=3; Nitrosomonadaceae|Rep: RhlE; ATP-dependent RNA
           helicase RhlE - Nitrosomonas europaea
          Length = 498

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 25/72 (34%), Positives = 39/72 (54%), Gaps = 1/72 (1%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL-LSLYRFY 284
           TF  + L  E+L  +   G+  P+ IQ + I   + G+DV+A AQ+GTGK    +L   Y
Sbjct: 6   TFAQLGLSSEILHAVNDEGYVNPTPIQAQVIPSILAGKDVMASAQTGTGKTAGFTLPLLY 65

Query: 285 NKSIQAFVNVKL 320
              +QA+ N  +
Sbjct: 66  R--LQAYANTSV 75



 Score = 41.9 bits (94), Expect = 0.016
 Identities = 27/75 (36%), Positives = 41/75 (54%), Gaps = 8/75 (10%)
 Frame = +2

Query: 254 KTATFSISILQQI----DTSIRECQ----ALILAPTRELAQQIQKVVIALGDHLNAKCHA 409
           KTA F++ +L ++    +TS+   +    ALI+APTRELA QI + V   G +L  +   
Sbjct: 55  KTAGFTLPLLYRLQAYANTSVSPARHPVRALIMAPTRELAMQIDESVRKYGKYLALRTAV 114

Query: 410 CIGGTNVREDIRQLE 454
             GG N+   I  L+
Sbjct: 115 VFGGINIEPQIAALQ 129


>UniRef50_Q3AZR1 Cluster: DEAD/DEAH box helicase-like; n=2;
           Synechococcus|Rep: DEAD/DEAH box helicase-like -
           Synechococcus sp. (strain CC9902)
          Length = 458

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 21/50 (42%), Positives = 31/50 (62%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           TF+ + L  E +R I   G+  P+ IQ   I   +QG+D++A AQ+GTGK
Sbjct: 25  TFEQLELCAETVRSIKESGYLSPTPIQALTIPEVLQGKDIMASAQTGTGK 74



 Score = 40.7 bits (91), Expect = 0.036
 Identities = 21/71 (29%), Positives = 39/71 (54%), Gaps = 4/71 (5%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIR----ECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 421
           KTA F + I++ +    +    +  +L+L PTRELA Q++    A   +L  +  A  GG
Sbjct: 74  KTAAFILPIIELLRAEDKPKRYQVHSLVLTPTRELAAQVEASAKAYTKYLALRSDAVFGG 133

Query: 422 TNVREDIRQLE 454
            ++R  +++L+
Sbjct: 134 VSIRPQVKRLQ 144


>UniRef50_Q4IZ16 Cluster: DEAD/DEAH box helicase:Helicase,
           C-terminal:DbpA RNA binding domain; n=18;
           Pseudomonadaceae|Rep: DEAD/DEAH box helicase:Helicase,
           C-terminal:DbpA RNA binding domain - Azotobacter
           vinelandii AvOP
          Length = 575

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 22/49 (44%), Positives = 31/49 (63%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F  + +   +L  I A G+E+PS IQ +AI   + G D+I QAQ+GTGK
Sbjct: 25  FAALGIHPAVLAAITAVGYEEPSPIQAQAIPVILAGHDMIGQAQTGTGK 73



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 21/35 (60%), Positives = 27/35 (77%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQI 358
           KTA F++ +L +ID + RE Q LILAPTRELA Q+
Sbjct: 73  KTAAFALPMLSRIDPARREPQLLILAPTRELALQV 107


>UniRef50_Q2BIX8 Cluster: Probable ATP-dependent RNA helicase; n=1;
           Neptuniibacter caesariensis|Rep: Probable ATP-dependent
           RNA helicase - Neptuniibacter caesariensis
          Length = 410

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 25/76 (32%), Positives = 42/76 (55%), Gaps = 3/76 (3%)
 Frame = +2

Query: 233 SSPVRNWKTATFSISILQQIDTS---IRECQALILAPTRELAQQIQKVVIALGDHLNAKC 403
           SSP  + KTA + I ++Q++       R+ +A++L P RELA+QI      L   L+   
Sbjct: 43  SSPTGSGKTAAYLIPVIQELSAGKSPTRQPKAIVLVPVRELAEQIASFFDKLAAGLDLNA 102

Query: 404 HACIGGTNVREDIRQL 451
            A +GG + ++  +QL
Sbjct: 103 VAIVGGEDFKKQEKQL 118


>UniRef50_Q15T34 Cluster: DEAD/DEAH box helicase-like; n=1;
           Pseudoalteromonas atlantica T6c|Rep: DEAD/DEAH box
           helicase-like - Pseudoalteromonas atlantica (strain T6c
           / BAA-1087)
          Length = 458

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 25/71 (35%), Positives = 39/71 (54%), Gaps = 4/71 (5%)
 Frame = +2

Query: 254 KTATFSISILQQI----DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 421
           KTA F++ +LQ++     T ++  ++LI+ PTRELA Q+   V      LN +  A  GG
Sbjct: 51  KTAAFTLPLLQRLAAKQSTKVQGVRSLIVTPTRELAAQVAISVEIYSTQLNIRSFAVYGG 110

Query: 422 TNVREDIRQLE 454
             +   I QL+
Sbjct: 111 VRIEPQIAQLQ 121



 Score = 39.5 bits (88), Expect = 0.083
 Identities = 18/50 (36%), Positives = 31/50 (62%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +F+ + L++EL+  I   G+   + IQ+ AI   +   D++A AQ+GTGK
Sbjct: 2   SFEALGLRDELIHAIATQGYSVATDIQREAIPLVLAQHDLLAVAQTGTGK 51


>UniRef50_Q01PH0 Cluster: DEAD/DEAH box helicase domain protein;
           n=1; Solibacter usitatus Ellin6076|Rep: DEAD/DEAH box
           helicase domain protein - Solibacter usitatus (strain
           Ellin6076)
          Length = 422

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 21/54 (38%), Positives = 32/54 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           F ++ L  +L   +    F +P+ IQ  AI P + G+D++A AQ+GTGK L  L
Sbjct: 4   FSELPLSAQLKSNLAKNNFTEPTPIQSLAIEPALAGKDIVATAQTGTGKTLAFL 57



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 23/68 (33%), Positives = 36/68 (52%), Gaps = 2/68 (2%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRE--CQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTN 427
           KT  F +  +Q + T  R+   +ALIL PTRELA QI + ++ +      +    +GG N
Sbjct: 52  KTLAFLLPTIQLLSTEPRQPGVRALILTPTRELALQINEALLQIARGTGIRAAVAVGGLN 111

Query: 428 VREDIRQL 451
            R  +R +
Sbjct: 112 ERSQLRDI 119


>UniRef50_A3EUK2 Cluster: Superfamily II DNA and RNA helicase; n=1;
           Leptospirillum sp. Group II UBA|Rep: Superfamily II DNA
           and RNA helicase - Leptospirillum sp. Group II UBA
          Length = 444

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 21/50 (42%), Positives = 32/50 (64%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           TF+ + L  E+LR +   G   P+ IQ+++I   I GRD++  AQ+GTGK
Sbjct: 2   TFEALGLSPEILRALNDLGHASPTPIQKQSIPHVIDGRDLLGIAQTGTGK 51



 Score = 34.7 bits (76), Expect = 2.4
 Identities = 22/70 (31%), Positives = 34/70 (48%), Gaps = 3/70 (4%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIREC---QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 424
           KT  F + +L +I    R     +AL+L+PTRELA QI +       +L+      +GG 
Sbjct: 51  KTGGFLLPVLHKIAEGRRHGIRNRALVLSPTRELATQIHQAAKDYAKYLHTNAVLLVGGV 110

Query: 425 NVREDIRQLE 454
           +     R L+
Sbjct: 111 DFIRQERNLK 120


>UniRef50_Q014Y7 Cluster: RNA helicase-like protein; n=2;
           Ostreococcus|Rep: RNA helicase-like protein -
           Ostreococcus tauri
          Length = 492

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 27/55 (49%), Positives = 36/55 (65%), Gaps = 4/55 (7%)
 Frame = +3

Query: 105 ETFDDMNLKEELLRGIYA-YGFEKPSAIQQRAIMPCI---QGRDVIAQAQSGTGK 257
           +TF+D+ L  ELLRG+Y    FEKPS IQ    +P I     R++IAQA +G+GK
Sbjct: 87  KTFEDLGLSAELLRGLYGEMKFEKPSKIQAET-LPLILMPPHRNLIAQAHNGSGK 140



 Score = 36.7 bits (81), Expect = 0.58
 Identities = 16/45 (35%), Positives = 28/45 (62%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDH 388
           KT  F++ +L +ID +++  Q L++ PTREL  Q   V+  +G +
Sbjct: 140 KTTCFTLGMLSRIDPAVKTPQGLMICPTRELVVQNVSVMERMGKY 184


>UniRef50_Q22308 Cluster: Putative uncharacterized protein; n=7;
           Bilateria|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 1022

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 26/60 (43%), Positives = 38/60 (63%), Gaps = 1/60 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F +++L +ID ++   Q + LAPT ELA+QI +VV  +G  + N K H  I G N+
Sbjct: 670 KTAAFVLTMLCRIDVNLMCPQCICLAPTLELAKQIGEVVEKMGKFIDNLKIHYAIKGGNM 729



 Score = 39.5 bits (88), Expect = 0.083
 Identities = 20/54 (37%), Positives = 34/54 (62%), Gaps = 2/54 (3%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQG--RDVIAQAQSGTGK 257
           + +F ++ LK E+L+ +    F+ P+ IQ+ A+   +     ++IAQAQSGTGK
Sbjct: 617 ISSFRELRLKPEVLKALDTMNFQFPTRIQETALPLLLMEPPSNLIAQAQSGTGK 670


>UniRef50_O97032 Cluster: DjVLGB; n=2; Dugesia|Rep: DjVLGB - Dugesia
           japonica (Planarian)
          Length = 781

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 21/63 (33%), Positives = 36/63 (57%)
 Frame = +3

Query: 99  VVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSLYR 278
           V+E FD++ L   +   I    +++P+ IQ+ AI   ++ RD++A AQ+G+GK    L  
Sbjct: 182 VIENFDELKLDPTIRNNILLASYQRPTPIQKNAIPAILEHRDIMACAQTGSGKTAAFLIP 241

Query: 279 FYN 287
             N
Sbjct: 242 IIN 244


>UniRef50_A7S2R2 Cluster: Predicted protein; n=5; Eumetazoa|Rep:
           Predicted protein - Nematostella vectensis
          Length = 643

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 22/57 (38%), Positives = 33/57 (57%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           VE F D  + +  L G+   GF  P+ IQ++ I   + GRDV+  A++G+GK L  L
Sbjct: 49  VEKFSDFPISKRTLDGLMKAGFVTPTDIQKQGIPVALSGRDVLGAAKTGSGKTLAFL 105



 Score = 37.9 bits (84), Expect = 0.25
 Identities = 22/70 (31%), Positives = 41/70 (58%), Gaps = 4/70 (5%)
 Frame = +2

Query: 254 KTATFSISILQ----QIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 421
           KT  F I I++    Q  TS+    AL+++PTRELA Q  +V++ +G+  +      IGG
Sbjct: 100 KTLAFLIPIIETLWRQKWTSMDGLGALVISPTRELAYQTFEVLVKIGNKHDLSAGLIIGG 159

Query: 422 TNVREDIRQL 451
            +++ + +++
Sbjct: 160 KDLKNEQKRI 169


>UniRef50_A5K8S1 Cluster: DEAD/DEAH box helicase, putative; n=1;
           Plasmodium vivax|Rep: DEAD/DEAH box helicase, putative -
           Plasmodium vivax
          Length = 862

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 27/82 (32%), Positives = 46/82 (56%)
 Frame = +3

Query: 72  GHLHTDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGT 251
           GH   D++ ++    D+ L++ +L   Y + F  P+ IQ+ AI   +QGRDVI  +++G+
Sbjct: 99  GHDFLDFENILL---DVRLRKAIL---YLFKFRHPTKIQKAAIPHILQGRDVIISSKTGS 152

Query: 252 GKLLLSLYRFYNKSIQAFVNVK 317
           GK +  L       I+A +N K
Sbjct: 153 GKTMAYLIPLVQNIIKANINEK 174


>UniRef50_A3QMD4 Cluster: Putative uncharacterized protein mel-46;
           n=2; Caenorhabditis elegans|Rep: Putative
           uncharacterized protein mel-46 - Caenorhabditis elegans
          Length = 973

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 21/53 (39%), Positives = 35/53 (66%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLL 266
           TF+ + + ++ L  +    F++PS +Q RAI   + GRD++ QA+SGTGK L+
Sbjct: 23  TFESLMIGQKTLERLKNSQFDRPSPVQARAIPVGLLGRDMLVQAKSGTGKTLV 75



 Score = 34.7 bits (76), Expect = 2.4
 Identities = 17/57 (29%), Positives = 32/57 (56%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 424
           KT  FS+  ++ +D+     Q +I+ PTRE++ QI++ V  +     A+    +GG+
Sbjct: 72  KTLVFSVLAVENLDSRSSHIQKVIVTPTREISVQIKETVRKVAP-TGARTSVYVGGS 127


>UniRef50_Q2GSC7 Cluster: Putative uncharacterized protein; n=6;
           Pezizomycotina|Rep: Putative uncharacterized protein -
           Chaetomium globosum (Soil fungus)
          Length = 1029

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 18/50 (36%), Positives = 35/50 (70%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +F ++ L   L++ +    FEKP+ +Q++AI   +QG+DV+ +A++G+GK
Sbjct: 307 SFAELGLDPRLVQAVAKQSFEKPTLVQRKAIPLALQGQDVLCKAKTGSGK 356


>UniRef50_Q2FKY7 Cluster: DEAD/DEAH box helicase-like; n=1;
           Methanospirillum hungatei JF-1|Rep: DEAD/DEAH box
           helicase-like - Methanospirillum hungatei (strain JF-1 /
           DSM 864)
          Length = 531

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 20/52 (38%), Positives = 31/52 (59%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           + +F D+ L   +++ I   G+E+P+ IQQ  I   + G DV  QA +GTGK
Sbjct: 3   IPSFSDLQLSPGIIKAIRDIGYEEPTPIQQEVIPLILAGNDVAGQAYTGTGK 54



 Score = 33.1 bits (72), Expect = 7.2
 Identities = 20/67 (29%), Positives = 30/67 (44%), Gaps = 1/67 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNA-KCHACIGGTNV 430
           KTA F I  ++    + R  Q ++L P+RELA Q+   +  L  H          GG  +
Sbjct: 54  KTAAFGIPAIELCQPANRNVQTIVLCPSRELAVQVGTELNKLAMHKKGISILPVYGGQPI 113

Query: 431 REDIRQL 451
              I+ L
Sbjct: 114 ERQIKAL 120


>UniRef50_Q7A4G0 Cluster: Probable DEAD-box ATP-dependent RNA
           helicase SA1885; n=13; Staphylococcus|Rep: Probable
           DEAD-box ATP-dependent RNA helicase SA1885 -
           Staphylococcus aureus (strain N315)
          Length = 506

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 17/52 (32%), Positives = 36/52 (69%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           ++ F ++ + +  ++ + + GF++P+ IQ+ +I   +QG D++ QAQ+GTGK
Sbjct: 1   MQNFKELGISDNTVQSLESMGFKEPTPIQKDSIPYALQGIDILGQAQTGTGK 52



 Score = 36.3 bits (80), Expect = 0.77
 Identities = 20/67 (29%), Positives = 34/67 (50%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KT  F I +++++    +  Q+LILAPTRELA Q+ + +         +     GG  + 
Sbjct: 52  KTGAFGIPLIEKV-VGKQGVQSLILAPTRELAMQVAEQLREFSRGQGVQVVTVFGGMPIE 110

Query: 434 EDIRQLE 454
             I+ L+
Sbjct: 111 RQIKALK 117


>UniRef50_Q5KC99 Cluster: ATP-dependent RNA helicase MAK5; n=2;
           Filobasidiella neoformans|Rep: ATP-dependent RNA
           helicase MAK5 - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 772

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 23/57 (40%), Positives = 33/57 (57%)
 Frame = +3

Query: 93  DQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           D ++  +  ++L   L R   A  F  P+AIQ RAI   I GRDV+  A++G+GK L
Sbjct: 168 DDLLPEWSSISLHPSLKRSFLASSFTAPTAIQSRAIPAGITGRDVVGVAETGSGKTL 224


>UniRef50_Q09903 Cluster: ATP-dependent RNA helicase drs1; n=1;
           Schizosaccharomyces pombe|Rep: ATP-dependent RNA
           helicase drs1 - Schizosaccharomyces pombe (Fission
           yeast)
          Length = 754

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 19/50 (38%), Positives = 31/50 (62%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +F  MNL   +L+G+   GFE P+ IQ + I   + G+D++  A +G+GK
Sbjct: 260 SFQSMNLSRPILKGLSNLGFEVPTQIQDKTIPLALLGKDIVGAAVTGSGK 309



 Score = 39.1 bits (87), Expect = 0.11
 Identities = 22/69 (31%), Positives = 35/69 (50%), Gaps = 3/69 (4%)
 Frame = +2

Query: 254 KTATFSISILQQI---DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 424
           KTA F + IL+++      +   + LIL PTRELA Q   V   +    +     CIGG 
Sbjct: 309 KTAAFIVPILERLLYRPKKVPTTRVLILCPTRELAMQCHSVATKIASFTDIMVCLCIGGL 368

Query: 425 NVREDIRQL 451
           +++   ++L
Sbjct: 369 SLKLQEQEL 377


>UniRef50_Q81QF0 Cluster: ATP-dependent RNA helicase, DEAD/DEAH box
           family; n=25; Firmicutes|Rep: ATP-dependent RNA
           helicase, DEAD/DEAH box family - Bacillus anthracis
          Length = 450

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 27/68 (39%), Positives = 40/68 (58%), Gaps = 1/68 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQI-QKVVIALGDHLNAKCHACIGGTNV 430
           KT  F + IL++ID    + QALI+APTRELA QI  ++   L    +    A  GG +V
Sbjct: 55  KTLAFVLPILEKIDPESSDVQALIVAPTRELALQITTEIKKMLVQREDINVLAIYGGQDV 114

Query: 431 REDIRQLE 454
            + +R+L+
Sbjct: 115 AQQLRKLK 122



 Score = 38.7 bits (86), Expect = 0.14
 Identities = 17/54 (31%), Positives = 32/54 (59%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           ++ F ++ + E     +   G  + + IQ++AI   + G+D+I QA++GTGK L
Sbjct: 4   LKNFLELGISETFNHTLRENGITEATPIQEKAIPVILSGKDIIGQAKTGTGKTL 57


>UniRef50_Q6MQY6 Cluster: ATP-dependent RNA helicase; n=1;
           Bdellovibrio bacteriovorus|Rep: ATP-dependent RNA
           helicase - Bdellovibrio bacteriovorus
          Length = 473

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 22/52 (42%), Positives = 31/52 (59%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           TF +MNL   LL  +      KP+ +Q +AI   + G D+IA AQ+G+GK L
Sbjct: 34  TFQEMNLAPVLLPALTKMKISKPTPVQSQAIPASLDGSDIIAIAQTGSGKTL 85



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 25/67 (37%), Positives = 36/67 (53%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KT  F++S+L  +     E + LIL P+RE+AQQI KV + L   +       IGGT   
Sbjct: 83  KTLAFALSLLTTLQKK-PEARGLILVPSREMAQQIYKVFLELCAEMPVSVCLAIGGTTGS 141

Query: 434 EDIRQLE 454
           +   QL+
Sbjct: 142 KQANQLK 148


>UniRef50_Q6MHS8 Cluster: ATP-dependent RNA helicase; n=1;
           Bdellovibrio bacteriovorus|Rep: ATP-dependent RNA
           helicase - Bdellovibrio bacteriovorus
          Length = 549

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 20/49 (40%), Positives = 31/49 (63%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F ++NL  +LL  I    ++  + IQ++AI P + G+DV   AQ+GTGK
Sbjct: 3   FSELNLDSQLLSAIQKLNYDDCTPIQEQAIPPVLDGKDVAGLAQTGTGK 51


>UniRef50_Q5ZT20 Cluster: ATP-dependent RNA helicase; n=4;
           Legionella pneumophila|Rep: ATP-dependent RNA helicase -
           Legionella pneumophila subsp. pneumophila (strain
           Philadelphia 1 /ATCC 33152 / DSM 7513)
          Length = 589

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 27/67 (40%), Positives = 35/67 (52%), Gaps = 1/67 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDH-LNAKCHACIGGTNV 430
           KTA F++ ILQ +   I   QALILAPTRELA Q+ +    L  +  N       GG   
Sbjct: 56  KTAAFALPILQNLSPEISTTQALILAPTRELAIQVAEQFELLSKYQRNVTIAVLCGGQEY 115

Query: 431 REDIRQL 451
              ++QL
Sbjct: 116 GRQLKQL 122



 Score = 42.7 bits (96), Expect = 0.009
 Identities = 22/55 (40%), Positives = 29/55 (52%)
 Frame = +3

Query: 93  DQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +Q +  F   N    L + +    F  PS IQ + I   +QGRD IA AQ+GTGK
Sbjct: 2   NQEISNFSTFNFSNALNKALEDMKFITPSPIQAQTIPLILQGRDAIALAQTGTGK 56


>UniRef50_Q5FS73 Cluster: ATP-dependent RNA helicase; n=2;
           Gluconobacter oxydans|Rep: ATP-dependent RNA helicase -
           Gluconobacter oxydans (Gluconobacter suboxydans)
          Length = 432

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 21/51 (41%), Positives = 33/51 (64%)
 Frame = +3

Query: 105 ETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           + F D+ L   LLR +   G+ KP+ IQ ++I   ++GRD++  AQ+GTGK
Sbjct: 7   QAFADLALAPTLLRALDEAGYVKPTPIQAQSIPLLLEGRDLLGLAQTGTGK 57



 Score = 35.1 bits (77), Expect = 1.8
 Identities = 21/72 (29%), Positives = 35/72 (48%), Gaps = 5/72 (6%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIREC-----QALILAPTRELAQQIQKVVIALGDHLNAKCHACIG 418
           KTA+F++ +L ++  + R       + L+LAPTREL  QI     +   H   +     G
Sbjct: 57  KTASFALPLLHRLAATPRPAPKNGARVLVLAPTRELVSQIADGFESFSRHQPVRVTTIFG 116

Query: 419 GTNVREDIRQLE 454
           G +    ++ LE
Sbjct: 117 GVSQVHQVKALE 128


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 816,127,611
Number of Sequences: 1657284
Number of extensions: 17890842
Number of successful extensions: 53589
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 49201
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 53184
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 59090914597
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).