SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0026
         (399 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q5MGF5 Cluster: Putative uncharacterized protein; n=2; ...    52   5e-06
UniRef50_Q0BU79 Cluster: Hypothetical cytosolic protein; n=1; Gr...    34   1.2  
UniRef50_P28618 Cluster: Pyrrolidone-carboxylate peptidase; n=12...    32   3.6  
UniRef50_Q4TGD5 Cluster: Chromosome undetermined SCAF3766, whole...    32   4.8  
UniRef50_O44565 Cluster: Laminin related. see also lmb-protein 1...    32   4.8  

>UniRef50_Q5MGF5 Cluster: Putative uncharacterized protein; n=2;
           Bombycoidea|Rep: Putative uncharacterized protein -
           Lonomia obliqua (Moth)
          Length = 74

 Score = 51.6 bits (118), Expect = 5e-06
 Identities = 24/47 (51%), Positives = 29/47 (61%)
 Frame = +2

Query: 113 IYGTGGLLTPLVAPVLXXXXXXXXXXXXXXXXXXYYGNLVAGSIVSQ 253
           IYGTGGLLTP+VAP+L                  YYGN+VAGS++SQ
Sbjct: 17  IYGTGGLLTPIVAPMLGFGSAGIAAGSTAAAAQAYYGNVVAGSVISQ 63


>UniRef50_Q0BU79 Cluster: Hypothetical cytosolic protein; n=1;
           Granulibacter bethesdensis CGDNIH1|Rep: Hypothetical
           cytosolic protein - Granulobacter bethesdensis (strain
           ATCC BAA-1260 / CGDNIH1)
          Length = 90

 Score = 33.9 bits (74), Expect = 1.2
 Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 2/40 (5%)
 Frame = +1

Query: 49  QKLKEHGA--SSCISGKRGRRCCNIWHWGSVDSISGSRAR 162
           Q L+EHG    S ++G+R  RC N WH G  D +   R R
Sbjct: 42  QALREHGTFQGSMLAGRRILRC-NPWHQGGYDPVPAGRCR 80


>UniRef50_P28618 Cluster: Pyrrolidone-carboxylate peptidase; n=12;
           Bacilli|Rep: Pyrrolidone-carboxylate peptidase -
           Bacillus subtilis
          Length = 215

 Score = 32.3 bits (70), Expect = 3.6
 Identities = 15/40 (37%), Positives = 21/40 (52%)
 Frame = +1

Query: 28  LRIARREQKLKEHGASSCISGKRGRRCCNIWHWGSVDSIS 147
           L + R   K+KEHG  + +S   G   CN   +G +D IS
Sbjct: 117 LPVKRMTAKMKEHGIPAAVSYTAGTFVCNYLFYGLMDHIS 156


>UniRef50_Q4TGD5 Cluster: Chromosome undetermined SCAF3766, whole
           genome shotgun sequence; n=1; Tetraodon
           nigroviridis|Rep: Chromosome undetermined SCAF3766,
           whole genome shotgun sequence - Tetraodon nigroviridis
           (Green puffer)
          Length = 328

 Score = 31.9 bits (69), Expect = 4.8
 Identities = 13/29 (44%), Positives = 20/29 (68%)
 Frame = -2

Query: 158 AREPLMESTDPQCHILQHRRPRLPLMQLE 72
           A +PL   T+P+  +LQ+RRP+L L  L+
Sbjct: 5   AEQPLSLRTEPKLRVLQYRRPKLELQLLK 33


>UniRef50_O44565 Cluster: Laminin related. see also lmb-protein 1;
            n=2; Caenorhabditis|Rep: Laminin related. see also
            lmb-protein 1 - Caenorhabditis elegans
          Length = 1067

 Score = 31.9 bits (69), Expect = 4.8
 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 2/37 (5%)
 Frame = +1

Query: 76   SCISGKRGRRC--CNIWHWGSVDSISGSRARFQLSGN 180
            +C SG +G RC  C   HWGS   + G+  R   +GN
Sbjct: 973  NCKSGYQGERCGECAQNHWGSPREVGGTCERCDCNGN 1009


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 349,819,444
Number of Sequences: 1657284
Number of extensions: 5720454
Number of successful extensions: 11286
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 10998
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11274
length of database: 575,637,011
effective HSP length: 92
effective length of database: 423,166,883
effective search space used: 16926675320
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).