SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0018
         (678 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI000069FA8B Cluster: Protein bassoon (Zinc finger pro...    40   0.042
UniRef50_Q23BV6 Cluster: Putative uncharacterized protein; n=1; ...    36   0.69 
UniRef50_A2F030 Cluster: Putative uncharacterized protein; n=1; ...    36   0.91 
UniRef50_Q5A8A5 Cluster: Potential sulfate transporter; n=5; Sac...    35   1.6  
UniRef50_UPI0000D55775 Cluster: PREDICTED: similar to activating...    35   2.1  
UniRef50_Q65NH0 Cluster: Putative uncharacterized protein; n=1; ...    34   2.8  
UniRef50_A0EAW7 Cluster: Chromosome undetermined scaffold_87, wh...    34   2.8  
UniRef50_UPI00006CD295 Cluster: Protein kinase domain containing...    34   3.7  
UniRef50_Q6X1Y7 Cluster: Effector protein B; n=6; Legionella pne...    34   3.7  
UniRef50_A4RKN1 Cluster: Putative uncharacterized protein; n=3; ...    34   3.7  
UniRef50_A2FA07 Cluster: Putative uncharacterized protein; n=1; ...    33   4.8  
UniRef50_A0CZE8 Cluster: Chromosome undetermined scaffold_32, wh...    33   4.8  
UniRef50_Q0TVL4 Cluster: Putative uncharacterized protein; n=1; ...    33   4.8  
UniRef50_A7EP09 Cluster: Putative uncharacterized protein; n=1; ...    33   4.8  
UniRef50_UPI0000E475AE Cluster: PREDICTED: similar to mKIAA1108 ...    33   6.4  
UniRef50_A0LJ36 Cluster: Cobalt transport protein; n=1; Syntroph...    33   6.4  
UniRef50_A2ELI0 Cluster: Putative uncharacterized protein; n=1; ...    33   6.4  
UniRef50_A6RXR2 Cluster: Predicted protein; n=1; Botryotinia fuc...    33   6.4  
UniRef50_UPI0000F2E2E9 Cluster: PREDICTED: similar to CG13625-PA...    33   8.4  
UniRef50_A2EYE7 Cluster: Putative uncharacterized protein; n=1; ...    33   8.4  
UniRef50_A5DWH9 Cluster: Putative uncharacterized protein; n=1; ...    33   8.4  

>UniRef50_UPI000069FA8B Cluster: Protein bassoon (Zinc finger
           protein 231).; n=2; Xenopus tropicalis|Rep: Protein
           bassoon (Zinc finger protein 231). - Xenopus tropicalis
          Length = 3608

 Score = 40.3 bits (90), Expect = 0.042
 Identities = 31/113 (27%), Positives = 54/113 (47%), Gaps = 8/113 (7%)
 Frame = +2

Query: 170 PQDYGEQTFTKYSNRS*KQARRLEGTFQASASVQY-EETKRDSCSVPKRKKNIQPLPIKS 346
           PQ Y  Q  +K   ++ +QA++ +   Q+   +Q  +ET   S  +     +  PLP ++
Sbjct: 181 PQ-YQSQVQSKLHAQN-QQAQKPQSQHQSPLHIQAGKETSHGSARIESIHSSASPLPQQA 238

Query: 347 KAKSLQNQNIIEAAFPISVPPKIIRKRSPRTRKVE-------TPRKTPTLRSH 484
           K +  Q +  I  A+P S  P+ + + SP+ +  E       +P KTP   SH
Sbjct: 239 KIQPTQQREQISQAYPKSSVPQEVLRSSPQHQPAEQRKTAGSSPAKTPAASSH 291


>UniRef50_Q23BV6 Cluster: Putative uncharacterized protein; n=1;
            Tetrahymena thermophila SB210|Rep: Putative
            uncharacterized protein - Tetrahymena thermophila SB210
          Length = 1225

 Score = 36.3 bits (80), Expect = 0.69
 Identities = 20/74 (27%), Positives = 34/74 (45%)
 Frame = +3

Query: 72   DALQRIMISFKHFEKKLDKLQDDVNDHGKTLGDLKTMVSKLSQNTVIGPESKLDDWRVPF 251
            D +  +  S K  EKK DK   +VN      G+    + K+ Q + +  E   ++    F
Sbjct: 864  DLVDSLKKSVKILEKKTDKKDSEVNQQLCDYGEKVKQIEKIQQESNLMVEKYTEELNKKF 923

Query: 252  KRLHQYSTKKQKEI 293
            K L + S KK +++
Sbjct: 924  KELKRNSVKKDEQL 937


>UniRef50_A2F030 Cluster: Putative uncharacterized protein; n=1;
            Trichomonas vaginalis G3|Rep: Putative uncharacterized
            protein - Trichomonas vaginalis G3
          Length = 1500

 Score = 35.9 bits (79), Expect = 0.91
 Identities = 24/96 (25%), Positives = 47/96 (48%), Gaps = 6/96 (6%)
 Frame = +2

Query: 206  SNRS*KQARRLEGTFQASASVQYEETKRDSCSVPKR-----KKNIQPLPIKSKAKSLQNQ 370
            S++   +A+  + + +   SV  + + + S S PK      +K  +P   K  +K    +
Sbjct: 1323 SDKKSSEAKSRKPSSETKKSVAKKSSAKKSASKPKSTNPSVEKPSKPKTTKKSSKKSTGK 1382

Query: 371  NIIEAAFP-ISVPPKIIRKRSPRTRKVETPRKTPTL 475
             +  +A P ++ PPK   K+S +T KV +   TP++
Sbjct: 1383 KVANSAPPSVAEPPKGKSKKSKKTSKVNSSESTPSI 1418


>UniRef50_Q5A8A5 Cluster: Potential sulfate transporter; n=5;
            Saccharomycetales|Rep: Potential sulfate transporter -
            Candida albicans (Yeast)
          Length = 998

 Score = 35.1 bits (77), Expect = 1.6
 Identities = 22/88 (25%), Positives = 38/88 (43%)
 Frame = +2

Query: 170  PQDYGEQTFTKYSNRS*KQARRLEGTFQASASVQYEETKRDSCSVPKRKKNIQPLPIKSK 349
            P  YG + F KY         R    FQA++   Y+E K +S    ++    Q  P+   
Sbjct: 797  PSSYGAKIFGKYGEFG---TPRTNQVFQAASKTVYDEHKTESKFESQKNSLFQKQPLSLI 853

Query: 350  AKSLQNQNIIEAAFPISVPPKIIRKRSP 433
              S Q  +  +A F  ++ P  ++++ P
Sbjct: 854  MLSFQGLSDKDAEFWSNITPYFVKEKIP 881


>UniRef50_UPI0000D55775 Cluster: PREDICTED: similar to activating
           transcription factor 6; n=1; Tribolium castaneum|Rep:
           PREDICTED: similar to activating transcription factor 6
           - Tribolium castaneum
          Length = 532

 Score = 34.7 bits (76), Expect = 2.1
 Identities = 21/61 (34%), Positives = 35/61 (57%), Gaps = 2/61 (3%)
 Frame = +2

Query: 323 IQP-LPIKSKAKSLQNQNIIEAAFPIS-VPPKIIRKRSPRTRKVETPRKTPTLRSHKGLE 496
           IQP LP++SK   L+N ++  +A  +S  PPK++   +  T  + T + TPT  S+  + 
Sbjct: 145 IQPKLPVRSKVVVLKNTDLKRSAPTVSPPPPKVVVLENIATVPITTAQLTPTTLSNSIIN 204

Query: 497 N 499
           N
Sbjct: 205 N 205


>UniRef50_Q65NH0 Cluster: Putative uncharacterized protein; n=1;
           Bacillus licheniformis ATCC 14580|Rep: Putative
           uncharacterized protein - Bacillus licheniformis (strain
           DSM 13 / ATCC 14580)
          Length = 127

 Score = 34.3 bits (75), Expect = 2.8
 Identities = 13/34 (38%), Positives = 21/34 (61%)
 Frame = +3

Query: 99  FKHFEKKLDKLQDDVNDHGKTLGDLKTMVSKLSQ 200
           FK  ++K+  L DD++  GK +  LKT + KL +
Sbjct: 87  FKQLKEKISSLNDDIDSLGKDISSLKTKIEKLEK 120


>UniRef50_A0EAW7 Cluster: Chromosome undetermined scaffold_87, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_87,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 607

 Score = 34.3 bits (75), Expect = 2.8
 Identities = 21/83 (25%), Positives = 41/83 (49%)
 Frame = +3

Query: 231 DDWRVPFKRLHQYSTKKQKEIHALFPRERKTYSHCQLNQKLRAYKIRTL*KQRFQFPFLQ 410
           D+ R+  +R  QY  K QK        ERK     ++ ++ R  K + + + R QF   Q
Sbjct: 250 DEKRIQLEREEQYKIKDQKRKQREEELERKRKEENKIKEEQRIEKQKKIQQDREQFLNRQ 309

Query: 411 K*LENVRLGLVKSKPLAKLPHYD 479
           + ++++RL  ++ K L +   ++
Sbjct: 310 QEIQDIRLKELQEKDLRRSQKFE 332


>UniRef50_UPI00006CD295 Cluster: Protein kinase domain containing
            protein; n=1; Tetrahymena thermophila SB210|Rep: Protein
            kinase domain containing protein - Tetrahymena
            thermophila SB210
          Length = 2322

 Score = 33.9 bits (74), Expect = 3.7
 Identities = 27/106 (25%), Positives = 52/106 (49%), Gaps = 8/106 (7%)
 Frame = +3

Query: 57   RARHTDALQRIMISF----KHFEKKLDKLQDDVNDHGKTLGDLKTMV----SKLSQNTVI 212
            R RH +  QR+  S+    K  +KK  +LQ    D  K +   + ++    S+L QN++ 
Sbjct: 1616 RQRHEEQFQRLEQSYIELQKEHKKKYSQLQKQYEDKQKEIEANQKVILEKYSQLEQNSMK 1675

Query: 213  GPESKLDDWRVPFKRLHQYSTKKQKEIHALFPRERKTYSHCQLNQK 350
              ES   +     ++L Q    KQK++ + F ++++ +   ++ QK
Sbjct: 1676 QRESIKKNIEFTVQQLQQEYETKQKDLFSEFEKKQRQFEE-RIRQK 1720


>UniRef50_Q6X1Y7 Cluster: Effector protein B; n=6; Legionella
            pneumophila|Rep: Effector protein B - Legionella
            pneumophila
          Length = 1294

 Score = 33.9 bits (74), Expect = 3.7
 Identities = 30/105 (28%), Positives = 57/105 (54%), Gaps = 4/105 (3%)
 Frame = +3

Query: 54   QRARHTDALQRIMISFKHFEKKLD-KLQDDVNDHGKTLGDLKTMVSKLS---QNTVIGPE 221
            Q+++   ALQ I+   K   ++L  K+Q+ V+ + + LG     +SK +   +NTV   +
Sbjct: 990  QQSKQIIALQEIIEDQKRQLEELKIKIQELVSAN-QELGKQNQSLSKENLHNKNTVEDLK 1048

Query: 222  SKLDDWRVPFKRLHQYSTKKQKEIHALFPRERKTYSHCQLNQKLR 356
             KL++  V  ++LHQ S +K++ I  L     K  S  + N++++
Sbjct: 1049 KKLNELNVQLEQLHQSSNEKEQTIRKLREELIKKDSSLKQNEEMQ 1093


>UniRef50_A4RKN1 Cluster: Putative uncharacterized protein; n=3;
           Sordariomycetes|Rep: Putative uncharacterized protein -
           Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 466

 Score = 33.9 bits (74), Expect = 3.7
 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 3/61 (4%)
 Frame = +3

Query: 108 FEKKLDKLQDDVNDHGKTLG---DLKTMVSKLSQNTVIGPESKLDDWRVPFKRLHQYSTK 278
           F++ +D L+D+V D+   +    DL+TM +K+ Q      E  + D R  F   + Y TK
Sbjct: 344 FKEPVDPLRDEVPDYFTKINRPMDLRTMKNKMDQRLYKDEEEFVADMRQIFTNCYTYWTK 403

Query: 279 K 281
           K
Sbjct: 404 K 404


>UniRef50_A2FA07 Cluster: Putative uncharacterized protein; n=1;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 994

 Score = 33.5 bits (73), Expect = 4.8
 Identities = 18/86 (20%), Positives = 41/86 (47%)
 Frame = +3

Query: 45  MALQRARHTDALQRIMISFKHFEKKLDKLQDDVNDHGKTLGDLKTMVSKLSQNTVIGPES 224
           + +Q+A++TD L++        EKKLD+  +D+      +  L+  +  L Q      +S
Sbjct: 565 LQVQKAKYTDTLKKYKNIILELEKKLDQDIEDMKSQKSEISSLQNQIEALKQENSAKDQS 624

Query: 225 KLDDWRVPFKRLHQYSTKKQKEIHAL 302
             ++     K+L Q + + + +  ++
Sbjct: 625 HKEEIDSLNKKLLQKNNEMKSQTDSM 650


>UniRef50_A0CZE8 Cluster: Chromosome undetermined scaffold_32, whole
           genome shotgun sequence; n=3; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_32,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 1064

 Score = 33.5 bits (73), Expect = 4.8
 Identities = 28/105 (26%), Positives = 52/105 (49%), Gaps = 7/105 (6%)
 Frame = +3

Query: 78  LQRIMISFKHFEKKLDKLQDDVNDHGKTL-GDLKTMVSKL--SQNTVIGPESKLD----D 236
           +++ +I  K  E +L++ +  +    ++L G LK    KL  S   +   ++K +    +
Sbjct: 140 IEKHIIRIKQLESELNEYKSKLGSVDQSLAGRLKEAERKLQDSDKELTNWKNKYNTDKTN 199

Query: 237 WRVPFKRLHQYSTKKQKEIHALFPRERKTYSHCQLNQKLRAYKIR 371
           W    +RL+   T+KQKE+      + K Y   QL Q+LR Y+ +
Sbjct: 200 WDNEIRRLNDLLTQKQKELDDYKNNQGKNYE--QLQQQLRQYETK 242


>UniRef50_Q0TVL4 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 723

 Score = 33.5 bits (73), Expect = 4.8
 Identities = 17/56 (30%), Positives = 30/56 (53%)
 Frame = +2

Query: 221 KQARRLEGTFQASASVQYEETKRDSCSVPKRKKNIQPLPIKSKAKSLQNQNIIEAA 388
           +Q ++LE    AS++V+ E     +   P   K I P P+  + ++ +NQ + EAA
Sbjct: 223 QQVQKLEQQAVASSTVKEETPTATNGVEPSNGKAISPAPVSEEVETARNQAVAEAA 278


>UniRef50_A7EP09 Cluster: Putative uncharacterized protein; n=1;
           Sclerotinia sclerotiorum 1980|Rep: Putative
           uncharacterized protein - Sclerotinia sclerotiorum 1980
          Length = 772

 Score = 33.5 bits (73), Expect = 4.8
 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 6/76 (7%)
 Frame = +2

Query: 278 ETKRDSCSVPKRKKNIQ-PLPIKSKAKSLQN-----QNIIEAAFPISVPPKIIRKRSPRT 439
           E    +   PKRK  I+   P K   KS+ N     +  ++ A P ++P + +  RSP T
Sbjct: 182 EPAAPAVEAPKRKSTIKFACPSKPTEKSVANVEPTEKTSLKLAVPDTLPRRRVPSRSPST 241

Query: 440 RKVETPRKTPTLRSHK 487
            +   P  T + R H+
Sbjct: 242 SRKPRPATTSSARPHR 257


>UniRef50_UPI0000E475AE Cluster: PREDICTED: similar to mKIAA1108
           protein, partial; n=1; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to mKIAA1108 protein,
           partial - Strongylocentrotus purpuratus
          Length = 904

 Score = 33.1 bits (72), Expect = 6.4
 Identities = 20/64 (31%), Positives = 34/64 (53%)
 Frame = +1

Query: 298 LCSQEKEKHTAIAN*IKS*ELTKSEHYRSSVSNFRSSKNN*KTFASDS*SRNPSQNSHTT 477
           +C Q+++ HT I++ IK  E+ K++  RS+ +   S K   K+  S S     ++N H  
Sbjct: 396 VCEQQQQNHTHISDEIKQKEVYKTDSNRSTNTKLESLKKAKKSLTS-SFENFLTRNKHRG 454

Query: 478 IPQR 489
            P R
Sbjct: 455 SPDR 458


>UniRef50_A0LJ36 Cluster: Cobalt transport protein; n=1;
           Syntrophobacter fumaroxidans MPOB|Rep: Cobalt transport
           protein - Syntrophobacter fumaroxidans (strain DSM 10017
           / MPOB)
          Length = 272

 Score = 33.1 bits (72), Expect = 6.4
 Identities = 15/49 (30%), Positives = 25/49 (51%)
 Frame = -3

Query: 205 VFCESLLTIVLRSPKVLPWSFTSSCNLSSFFSKCLKEIIIRCKASVWRA 59
           +FC   +++  R P VLPW   +   L   F  C +  +I C A+++ A
Sbjct: 78  IFCLQAVSLSGREPSVLPWLTVTKPGLVLAFLSCWRLALILCYATLFTA 126


>UniRef50_A2ELI0 Cluster: Putative uncharacterized protein; n=1;
            Trichomonas vaginalis G3|Rep: Putative uncharacterized
            protein - Trichomonas vaginalis G3
          Length = 1434

 Score = 33.1 bits (72), Expect = 6.4
 Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 1/66 (1%)
 Frame = +2

Query: 275  EETKRDSCSVPKRKKNIQPLPIKSKAKSLQNQNIIEAAF-PISVPPKIIRKRSPRTRKVE 451
            ++TKR S   P + K  QP   K K  SL+ +   + +  P S P K    +  +TRK+ 
Sbjct: 1167 KQTKRSSLPPPHKSKIPQPSNFKPK-NSLKLELFDQISVEPSSEPQKTNIPQKKKTRKLP 1225

Query: 452  TPRKTP 469
            TP++ P
Sbjct: 1226 TPKRKP 1231


>UniRef50_A6RXR2 Cluster: Predicted protein; n=1; Botryotinia
           fuckeliana B05.10|Rep: Predicted protein - Botryotinia
           fuckeliana B05.10
          Length = 609

 Score = 33.1 bits (72), Expect = 6.4
 Identities = 20/73 (27%), Positives = 37/73 (50%)
 Frame = +2

Query: 305 PKRKKNIQPLPIKSKAKSLQNQNIIEAAFPISVPPKIIRKRSPRTRKVETPRKTPTLRSH 484
           P +K+ + PL       SL  ++   ++   ++PPK  +KR PR +K+ TP +    R  
Sbjct: 128 PSKKRTLSPLAHTKDTHSLTTESNSNSSIA-ALPPK--KKRRPRAKKILTPAEILRAREK 184

Query: 485 KGLENKHSS*KSR 523
              +N+ ++ K R
Sbjct: 185 YLEKNRRAARKCR 197


>UniRef50_UPI0000F2E2E9 Cluster: PREDICTED: similar to CG13625-PA;
           n=1; Monodelphis domestica|Rep: PREDICTED: similar to
           CG13625-PA - Monodelphis domestica
          Length = 284

 Score = 32.7 bits (71), Expect = 8.4
 Identities = 28/89 (31%), Positives = 42/89 (47%), Gaps = 4/89 (4%)
 Frame = +2

Query: 257 SASVQYEETKRDSCSVPKRKKNIQPLPIKSKAKSLQNQNIIEAAFPISVPPKI-IRKRSP 433
           SA    E+T+    S P++ +  Q  P +++  S Q+    E   P S P K  +R+ +P
Sbjct: 131 SARQHPEKTETPPGSTPRKPRLRQAAPRENRDSSRQHPEKTETP-PGSTPRKPRLRQAAP 189

Query: 434 RTRKVET---PRKTPTLRSHKGLENKHSS 511
           R  +      P KT TLR     EN+ SS
Sbjct: 190 RESRDSARQHPEKTETLRQAAPRENRDSS 218


>UniRef50_A2EYE7 Cluster: Putative uncharacterized protein; n=1;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 257

 Score = 32.7 bits (71), Expect = 8.4
 Identities = 17/59 (28%), Positives = 30/59 (50%)
 Frame = +3

Query: 111 EKKLDKLQDDVNDHGKTLGDLKTMVSKLSQNTVIGPESKLDDWRVPFKRLHQYSTKKQK 287
           +K+L K  + +    K + DL+   SKL  N  IG +  L       +++H++ TK+ K
Sbjct: 19  QKELQKANEKIQLQEKQINDLRIENSKLRGN--IGVQEDLQSQNTALRQIHEHMTKEHK 75


>UniRef50_A5DWH9 Cluster: Putative uncharacterized protein; n=1;
           Lodderomyces elongisporus NRRL YB-4239|Rep: Putative
           uncharacterized protein - Lodderomyces elongisporus
           (Yeast) (Saccharomyces elongisporus)
          Length = 289

 Score = 32.7 bits (71), Expect = 8.4
 Identities = 23/64 (35%), Positives = 35/64 (54%), Gaps = 1/64 (1%)
 Frame = +2

Query: 275 EETKRDSCSVPKRKKNIQPLPIKSKAKSLQNQNIIEAAFPISVPPKIIRKRSP-RTRKVE 451
           +ET      V K+  + QPL  K K+K+L + +   + FP+S    +IRKR P    K E
Sbjct: 227 DETYTYLRDVLKQSNSKQPLK-KKKSKALSSPS---STFPVSATNDLIRKRKPDADDKPE 282

Query: 452 TPRK 463
           TP++
Sbjct: 283 TPKR 286


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 573,691,509
Number of Sequences: 1657284
Number of extensions: 10491635
Number of successful extensions: 34402
Number of sequences better than 10.0: 21
Number of HSP's better than 10.0 without gapping: 33007
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 34368
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 52479343733
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).