SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0099
         (684 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A5PLD0 Cluster: Zgc:165536 protein; n=12; Fungi/Metazoa...   118   2e-25
UniRef50_O04892 Cluster: Cytochrome P450 like_TBP; n=10; Eukaryo...   103   3e-21
UniRef50_Q7QQI2 Cluster: GLP_748_1200_211; n=1; Giardia lamblia ...    81   3e-14
UniRef50_UPI0000D57947 Cluster: PREDICTED: hypothetical protein;...    79   1e-13
UniRef50_Q9AVH2 Cluster: Putative senescence-associated protein;...    76   9e-13
UniRef50_A4VF70 Cluster: Putative uncharacterized protein; n=1; ...    70   5e-11
UniRef50_Q4P3R9 Cluster: Putative uncharacterized protein; n=3; ...    57   5e-07
UniRef50_UPI00006A2901 Cluster: UPI00006A2901 related cluster; n...    56   1e-06
UniRef50_A4VF71 Cluster: Putative uncharacterized protein; n=1; ...    55   2e-06
UniRef50_Q6L6Z5 Cluster: RRNA intron-encoded endonuclease; n=3; ...    53   6e-06
UniRef50_Q7QQI1 Cluster: GLP_748_557_1225; n=1; Giardia lamblia ...    47   4e-04
UniRef50_O57960 Cluster: Putative uncharacterized protein PH0221...    47   4e-04
UniRef50_A5AX63 Cluster: Putative uncharacterized protein; n=1; ...    44   0.003
UniRef50_A5K5F4 Cluster: Senescence-associated protein, putative...    42   0.011
UniRef50_UPI0000DA4670 Cluster: PREDICTED: hypothetical protein;...    42   0.019
UniRef50_Q6QI74 Cluster: LRRG00134; n=6; Euteleostomi|Rep: LRRG0...    41   0.032
UniRef50_Q14C49 Cluster: 4933429F08Rik protein; n=3; Euarchontog...    41   0.032
UniRef50_Q54SH1 Cluster: Putative uncharacterized protein; n=1; ...    41   0.032
UniRef50_Q7RN96 Cluster: Putative senescence-associated protein;...    40   0.043
UniRef50_A5B940 Cluster: Putative uncharacterized protein; n=1; ...    40   0.056
UniRef50_Q3E811 Cluster: Uncharacterized protein YLR162W-A; n=47...    39   0.099
UniRef50_Q0DV44 Cluster: Os03g0151000 protein; n=1; Oryza sativa...    38   0.17 
UniRef50_O04059 Cluster: Putative 3,4-dihydroxy-2-butanone kinas...    38   0.17 
UniRef50_Q4RRS5 Cluster: Chromosome 16 SCAF15002, whole genome s...    38   0.30 
UniRef50_Q4HL63 Cluster: Lipoprotein, putative; n=11; Bacteria|R...    38   0.30 
UniRef50_Q96F05 Cluster: Uncharacterized protein C11orf24 precur...    36   0.70 
UniRef50_UPI0000E254D5 Cluster: PREDICTED: plectin 1; n=3; Amnio...    36   1.2  
UniRef50_A5ZYV6 Cluster: Putative uncharacterized protein; n=1; ...    36   1.2  
UniRef50_A1UND9 Cluster: Putative secreted protein precursor; n=...    35   1.6  
UniRef50_Q60QM7 Cluster: Putative uncharacterized protein CBG217...    35   1.6  
UniRef50_Q4PCA4 Cluster: Putative uncharacterized protein; n=1; ...    35   2.1  
UniRef50_A5UR23 Cluster: Tetratricopeptide TPR_2 repeat protein;...    34   2.8  
UniRef50_A4LZ01 Cluster: Beta-ketoacyl synthase; n=2; cellular o...    34   2.8  
UniRef50_UPI0000E81AF1 Cluster: PREDICTED: hypothetical protein;...    33   4.9  
UniRef50_A5ZYV5 Cluster: Putative uncharacterized protein; n=7; ...    33   6.5  
UniRef50_A4RG52 Cluster: Putative uncharacterized protein; n=1; ...    33   6.5  
UniRef50_UPI0000DD7F3C Cluster: PREDICTED: hypothetical protein;...    33   8.6  
UniRef50_Q4S9Z6 Cluster: Chromosome undetermined SCAF14693, whol...    33   8.6  
UniRef50_Q4QEU8 Cluster: Putative uncharacterized protein; n=3; ...    33   8.6  
UniRef50_A4HFN4 Cluster: Putative uncharacterized protein; n=3; ...    33   8.6  

>UniRef50_A5PLD0 Cluster: Zgc:165536 protein; n=12; Fungi/Metazoa
           group|Rep: Zgc:165536 protein - Danio rerio (Zebrafish)
           (Brachydanio rerio)
          Length = 55

 Score =  118 bits (283), Expect = 2e-25
 Identities = 50/55 (90%), Positives = 53/55 (96%)
 Frame = +3

Query: 66  MPRHLISDAHEWINEIPTVPIYYLAKPQPRERAWENQRGKKTLLSLTLVWHCKET 230
           MPRHLISDAHEW+NEIPTVP  YLAKPQPRERAW+NQRGKKTLLSLTLVWHC+ET
Sbjct: 1   MPRHLISDAHEWMNEIPTVPTCYLAKPQPRERAWQNQRGKKTLLSLTLVWHCEET 55


>UniRef50_O04892 Cluster: Cytochrome P450 like_TBP; n=10;
           Eukaryota|Rep: Cytochrome P450 like_TBP - Nicotiana
           tabacum (Common tobacco)
          Length = 530

 Score =  103 bits (248), Expect = 3e-21
 Identities = 77/159 (48%), Positives = 89/159 (55%)
 Frame = -1

Query: 477 MYRPSQTPRLAVSSNRITREF*TATSVSATSPLCTLGTKHRAPADIIDRAPLPPNRVSNE 298
           M RPSQTP L +SS RI  +              +LG+K R  A      PLP + +S  
Sbjct: 1   MCRPSQTPHLTMSSARIGLQ-------------ASLGSKKRGSA------PLPIHGISKI 41

Query: 297 TMKVVVFQRRSRETTPTYATPLMSPYNARLESSSTGSSFPADSPKPVPLAVVSLDSR*GQ 118
           T+KVVVF  R   + PTY TPL S +   LESSSTGSSFPADS KPVPL VVSLDSR   
Sbjct: 42  TLKVVVFHFRL--SAPTYTTPLKSFHKVGLESSSTGSSFPADSAKPVPLVVVSLDSRQDS 99

Query: 117 WESR*SIHARH*LDDEAFGYLKRVIVTPAVYPRLLEFLH 1
             S  SIHA           L+    +P VYPRL+EFLH
Sbjct: 100 GISL-SIHAVTNKMTRHLATLRESCYSP-VYPRLVEFLH 136


>UniRef50_Q7QQI2 Cluster: GLP_748_1200_211; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_748_1200_211 - Giardia lamblia ATCC
           50803
          Length = 329

 Score = 80.6 bits (190), Expect = 3e-14
 Identities = 45/70 (64%), Positives = 46/70 (65%)
 Frame = -1

Query: 210 LESSSTGSSFPADSPKPVPLAVVSLDSR*GQWESR*SIHARH*LDDEAFGYLKRVIVTPA 31
           LESSS GSS PA  P PVP A  S     GQW+ R SIHAR  L DEAFGYLKRVIVTPA
Sbjct: 178 LESSSKGSSCPAGRPSPVPEAGGSRRRGSGQWDPRWSIHARRKLPDEAFGYLKRVIVTPA 237

Query: 30  VYPRLLEFLH 1
           VY      LH
Sbjct: 238 VYQGFGGSLH 247


>UniRef50_UPI0000D57947 Cluster: PREDICTED: hypothetical protein;
           n=1; Tribolium castaneum|Rep: PREDICTED: hypothetical
           protein - Tribolium castaneum
          Length = 70

 Score = 79.0 bits (186), Expect = 1e-13
 Identities = 37/41 (90%), Positives = 39/41 (95%)
 Frame = -1

Query: 255 TPTYATPLMSPYNARLESSSTGSSFPADSPKPVPLAVVSLD 133
           +PTYATPLMSPYNARLESSSTGSSFPA+  KPVPLAVVSLD
Sbjct: 13  SPTYATPLMSPYNARLESSSTGSSFPANFSKPVPLAVVSLD 53



 Score = 35.9 bits (79), Expect = 0.92
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = -2

Query: 125 RDSGNLVNPFMRVTN 81
           RDSGNLVNPFMRVTN
Sbjct: 56  RDSGNLVNPFMRVTN 70


>UniRef50_Q9AVH2 Cluster: Putative senescence-associated protein;
           n=4; Eukaryota|Rep: Putative senescence-associated
           protein - Pisum sativum (Garden pea)
          Length = 282

 Score = 75.8 bits (178), Expect = 9e-13
 Identities = 52/111 (46%), Positives = 61/111 (54%)
 Frame = -3

Query: 511 AALGHLRYSLTDVPPQSNSPPGSVLEPDHAGVLNGDERFRHVTTLHAWNETPCARRYYRP 332
           ++LGHLRY LTDVPPQ NSPP +V  PD              T +  W +    RR    
Sbjct: 167 SSLGHLRYLLTDVPPQPNSPPDNVFRPDRP------------TKVSLWIKKEGQRRPPDS 214

Query: 331 RTASAQPSK**NNESSGFSATIARNDSHLCYTSHVSLQCQTRVKLNRVFFP 179
           R      +K  N +SSG S T A + SHL YTS V  Q +TRVKLNRVFFP
Sbjct: 215 R------NKLNNVKSSGIS-TFAVSSSHLSYTSQVISQSRTRVKLNRVFFP 258



 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 39/58 (67%), Positives = 41/58 (70%)
 Frame = -2

Query: 683 WLPQASYPCGNFSGTSC*KLFILKDR*AVLSQSLCVLNIWIKPAFALLLHARFLSSLS 510
           WLPQASYPCGNFS TS  K   LKDR A LS+ + VL I IK AF LL H RFL SLS
Sbjct: 109 WLPQASYPCGNFSDTSSFKFRSLKDRLATLSRFVFVLEIRIKRAFTLLFHTRFLFSLS 166



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 23/48 (47%), Positives = 31/48 (64%)
 Frame = -1

Query: 249 TYATPLMSPYNARLESSSTGSSFPADSPKPVPLAVVSLDSR*GQWESR 106
           +Y + ++S    R++ +     FPADS K VPL +VSLDSR GQWE R
Sbjct: 237 SYTSQVISQSRTRVKLNRV--FFPADSAKAVPLLLVSLDSRKGQWEFR 282


>UniRef50_A4VF70 Cluster: Putative uncharacterized protein; n=1;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 116

 Score = 70.1 bits (164), Expect = 5e-11
 Identities = 37/59 (62%), Positives = 43/59 (72%)
 Frame = +1

Query: 508 QLSEDRNLAWSKRAKAGLIQMFSTHRDCESTAYRSFSIKSF*QEVPEKLPQG*LACGSQ 684
           QLSE+ NL  +KR KA LI +FS + + ES AYRSF+  SF  EV EKLPQG LACGSQ
Sbjct: 23  QLSENGNLTQNKRVKATLILIFSRNTNRESVAYRSFNFTSFKLEVSEKLPQGQLACGSQ 81


>UniRef50_Q4P3R9 Cluster: Putative uncharacterized protein; n=3;
           Dikarya|Rep: Putative uncharacterized protein - Ustilago
           maydis (Smut fungus)
          Length = 160

 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 43/108 (39%), Positives = 50/108 (46%)
 Frame = -3

Query: 505 LGHLRYSLTDVPPQSNSPPGSVLEPDHAGVLNGDERFRHVTTLHAWNETPCARRYYRPRT 326
           LGHLRY LTDVPPQ NSPP +V         N D+ +  +T LH W              
Sbjct: 64  LGHLRYRLTDVPPQPNSPPDNVS--------NSDQAYMLLTPLH-WI------------- 101

Query: 325 ASAQPSK**NNESSGFSATIARNDSHLCYTSHVSLQCQTRVKLNRVFF 182
                    + E+        R  SHL YT HVS QCQTRVKLN   +
Sbjct: 102 ---------SKETMEVVVFHRRRSSHLFYTLHVSSQCQTRVKLNHAAY 140



 Score = 42.3 bits (95), Expect = 0.011
 Identities = 16/16 (100%), Positives = 16/16 (100%)
 Frame = -2

Query: 683 WLPQASYPCGNFSGTS 636
           WLPQASYPCGNFSGTS
Sbjct: 4   WLPQASYPCGNFSGTS 19



 Score = 39.5 bits (88), Expect = 0.075
 Identities = 19/38 (50%), Positives = 24/38 (63%)
 Frame = -1

Query: 618 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELP 505
           +KGSIG  F V + TE+ +Q  F PF   E+SVL E P
Sbjct: 26  SKGSIGHTFMVCIHTENQNQGDFYPFVLLEISVLHESP 63


>UniRef50_UPI00006A2901 Cluster: UPI00006A2901 related cluster; n=1;
           Xenopus tropicalis|Rep: UPI00006A2901 UniRef100 entry -
           Xenopus tropicalis
          Length = 154

 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 24/26 (92%), Positives = 26/26 (100%)
 Frame = -1

Query: 78  DDEAFGYLKRVIVTPAVYPRLLEFLH 1
           +DEAFGYLKRVIVTPAVYPRL+EFLH
Sbjct: 113 NDEAFGYLKRVIVTPAVYPRLVEFLH 138



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 22/38 (57%), Positives = 26/38 (68%)
 Frame = -1

Query: 621 YTKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAEL 508
           Y  GSIG AF V +RTE+ +Q SF PF   E+SVL EL
Sbjct: 25  YPCGSIGHAFTVCIRTENQNQMSFYPFVLHEISVLVEL 62



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 19/26 (73%), Positives = 20/26 (76%)
 Frame = -3

Query: 505 LGHLRYSLTDVPPQSNSPPGSVLEPD 428
           LGHLRY LTDVPPQ NSPP +V   D
Sbjct: 64  LGHLRYLLTDVPPQPNSPPDNVFHLD 89


>UniRef50_A4VF71 Cluster: Putative uncharacterized protein; n=1;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 70

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 27/35 (77%), Positives = 29/35 (82%)
 Frame = -1

Query: 222 YNARLESSSTGSSFPADSPKPVPLAVVSLDSR*GQ 118
           +  RLESSSTGSSFPAD  KPVPLA+ SLDSR GQ
Sbjct: 19  HKVRLESSSTGSSFPADYSKPVPLAMGSLDSRQGQ 53


>UniRef50_Q6L6Z5 Cluster: RRNA intron-encoded endonuclease; n=3;
           Thermoproteaceae|Rep: RRNA intron-encoded endonuclease -
           Thermoproteus sp. IC-061
          Length = 234

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 22/46 (47%), Positives = 29/46 (63%)
 Frame = +3

Query: 84  SDAHEWINEIPTVPIYYLAKPQPRERAWENQRGKKTLLSLTLVWHC 221
           S  HEWINE+PTVP    A P P  ++W+ +RG+K+L S T    C
Sbjct: 177 SGVHEWINEVPTVPARGPANPPPGAQSWDPRRGEKSLWSFTAACRC 222


>UniRef50_Q7QQI1 Cluster: GLP_748_557_1225; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_748_557_1225 - Giardia lamblia ATCC
           50803
          Length = 222

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 24/41 (58%), Positives = 25/41 (60%)
 Frame = +2

Query: 98  MD*RDSHCPYLLSSETTAKGTGLGESAGKEDPVELDSSLAL 220
           MD R SHCP     E  A GTG G  AG+EDP ELDSS  L
Sbjct: 1   MDQRGSHCPEPRLREPPASGTGEGRPAGQEDPFELDSSPGL 41


>UniRef50_O57960 Cluster: Putative uncharacterized protein PH0221;
           n=2; Pyrococcus|Rep: Putative uncharacterized protein
           PH0221 - Pyrococcus horikoshii
          Length = 235

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 29/56 (51%), Positives = 31/56 (55%)
 Frame = -1

Query: 192 GSSFPADSPKPVPLAVVSLDSR*GQWESR*SIHARH*LDDEAFGYLKRVIVTPAVY 25
           GSS P   P     A VS     GQ   R +IHA   L D+ F YLKRVIVTPAVY
Sbjct: 2   GSSLPTGGPWHARQAEVSPGPGRGQRGPRYAIHAGRHLTDKEFRYLKRVIVTPAVY 57


>UniRef50_A5AX63 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 421

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 17/24 (70%), Positives = 20/24 (83%)
 Frame = +3

Query: 75  HLISDAHEWINEIPTVPIYYLAKP 146
           HLISDAHEWIN+ PT+ +YY  KP
Sbjct: 398 HLISDAHEWINKNPTILVYYPTKP 421


>UniRef50_A5K5F4 Cluster: Senescence-associated protein, putative;
           n=1; Plasmodium vivax|Rep: Senescence-associated
           protein, putative - Plasmodium vivax
          Length = 131

 Score = 42.3 bits (95), Expect = 0.011
 Identities = 18/21 (85%), Positives = 18/21 (85%)
 Frame = -3

Query: 502 GHLRYSLTDVPPQSNSPPGSV 440
           GHLRY LTDVPPQSNSPP  V
Sbjct: 87  GHLRYYLTDVPPQSNSPPDYV 107



 Score = 39.9 bits (89), Expect = 0.056
 Identities = 19/36 (52%), Positives = 25/36 (69%)
 Frame = -1

Query: 615 KGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAEL 508
           KGSIG AF     +E  +Q SF PF+ +E+SVL+EL
Sbjct: 49  KGSIGHAFTFSTFSESRNQTSFSPFSLQEISVLSEL 84



 Score = 37.1 bits (82), Expect = 0.40
 Identities = 14/16 (87%), Positives = 14/16 (87%)
 Frame = -2

Query: 683 WLPQASYPCGNFSGTS 636
           W PQASYPCGNFS TS
Sbjct: 19  WQPQASYPCGNFSDTS 34


>UniRef50_UPI0000DA4670 Cluster: PREDICTED: hypothetical protein;
           n=1; Rattus norvegicus|Rep: PREDICTED: hypothetical
           protein - Rattus norvegicus
          Length = 440

 Score = 41.5 bits (93), Expect = 0.019
 Identities = 15/18 (83%), Positives = 16/18 (88%)
 Frame = -2

Query: 476 CTAPVKLPAWQCPRTGSR 423
           CTAPVKLP W CPR+GSR
Sbjct: 75  CTAPVKLPTWHCPRSGSR 92


>UniRef50_Q6QI74 Cluster: LRRG00134; n=6; Euteleostomi|Rep:
           LRRG00134 - Rattus norvegicus (Rat)
          Length = 221

 Score = 40.7 bits (91), Expect = 0.032
 Identities = 16/19 (84%), Positives = 16/19 (84%)
 Frame = -2

Query: 683 WLPQASYPCGNFSGTSC*K 627
           W PQASYPCGNFS TSC K
Sbjct: 56  WPPQASYPCGNFSDTSCLK 74


>UniRef50_Q14C49 Cluster: 4933429F08Rik protein; n=3;
           Euarchontoglires|Rep: 4933429F08Rik protein - Mus
           musculus (Mouse)
          Length = 29

 Score = 40.7 bits (91), Expect = 0.032
 Identities = 16/19 (84%), Positives = 16/19 (84%)
 Frame = -2

Query: 683 WLPQASYPCGNFSGTSC*K 627
           W PQASYPCGNFS TSC K
Sbjct: 4   WPPQASYPCGNFSDTSCLK 22


>UniRef50_Q54SH1 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 1346

 Score = 40.7 bits (91), Expect = 0.032
 Identities = 33/113 (29%), Positives = 56/113 (49%), Gaps = 4/113 (3%)
 Frame = -1

Query: 465 SQTPRLAVSSNRITREF*TATSVSATSPLCTLGTKHRAPADIIDRAPLPPNRVSNETMKV 286
           S TP+ +++ NR++  F   T+ S+T     L    R+ +     +   PNR+S+   KV
Sbjct: 316 SLTPQKSLTPNRLSGTFPRTTTSSSTPTSSPL----RSTSSTTTTSSSTPNRLSSTINKV 371

Query: 285 VVFQ---RRSRETTPTY-ATPLMSPYNARLESSSTGSSFPADSPKPVPLAVVS 139
           V        S  ++PT  ATPL     ++L S+++ SS  + +P   PL+  S
Sbjct: 372 VSSSPSSTSSSSSSPTRSATPLPPTSTSKLSSTTSSSSSSSSTPNKTPLSTRS 424


>UniRef50_Q7RN96 Cluster: Putative senescence-associated protein;
           n=3; Eukaryota|Rep: Putative senescence-associated
           protein - Plasmodium yoelii yoelii
          Length = 205

 Score = 40.3 bits (90), Expect = 0.043
 Identities = 18/23 (78%), Positives = 19/23 (82%)
 Frame = -1

Query: 75  DEAFGYLKRVIVTPAVYPRLLEF 7
           DE FGYLKRVIVTPAVY   +EF
Sbjct: 144 DETFGYLKRVIVTPAVYLCFIEF 166



 Score = 38.7 bits (86), Expect = 0.13
 Identities = 17/21 (80%), Positives = 17/21 (80%)
 Frame = -3

Query: 502 GHLRYSLTDVPPQSNSPPGSV 440
           GHL Y LTDVPPQSNSP G V
Sbjct: 65  GHLCYFLTDVPPQSNSPSGYV 85



 Score = 37.9 bits (84), Expect = 0.23
 Identities = 19/38 (50%), Positives = 24/38 (63%)
 Frame = -1

Query: 621 YTKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAEL 508
           Y  GSIG AF     +E  +Q SF PF+ +E+SVL EL
Sbjct: 25  YPCGSIGHAFTFSTFSESRNQTSFSPFSLQEISVLFEL 62


>UniRef50_A5B940 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 108

 Score = 39.9 bits (89), Expect = 0.056
 Identities = 17/22 (77%), Positives = 18/22 (81%)
 Frame = -3

Query: 505 LGHLRYSLTDVPPQSNSPPGSV 440
           LGHLRY LTDV PQ NSPP +V
Sbjct: 62  LGHLRYLLTDVSPQPNSPPDNV 83


>UniRef50_Q3E811 Cluster: Uncharacterized protein YLR162W-A; n=47;
           Eukaryota|Rep: Uncharacterized protein YLR162W-A -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 62

 Score = 39.1 bits (87), Expect = 0.099
 Identities = 16/18 (88%), Positives = 16/18 (88%)
 Frame = -3

Query: 505 LGHLRYSLTDVPPQSNSP 452
           LGHLRY LTDVPPQ NSP
Sbjct: 30  LGHLRYRLTDVPPQPNSP 47


>UniRef50_Q0DV44 Cluster: Os03g0151000 protein; n=1; Oryza sativa
           (japonica cultivar-group)|Rep: Os03g0151000 protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 113

 Score = 38.3 bits (85), Expect = 0.17
 Identities = 24/59 (40%), Positives = 28/59 (47%)
 Frame = -2

Query: 521 SSLSCLRTPALFVDRCTAPVKLPAWQCPRTGSRGSFKRRRAFPPRHHSARLERNTVRPP 345
           SS  C R+P L   R   PV       P T  R S +RRR+ PP  H+ R  R   RPP
Sbjct: 9   SSTRCRRSPPLPHQRSPPPVSSSPLPAPATDGRSSARRRRS-PPIPHACR-RREIERPP 65


>UniRef50_O04059 Cluster: Putative 3,4-dihydroxy-2-butanone kinase;
           n=12; Magnoliophyta|Rep: Putative
           3,4-dihydroxy-2-butanone kinase - Solanum lycopersicum
           (Tomato) (Lycopersicon esculentum)
          Length = 594

 Score = 38.3 bits (85), Expect = 0.17
 Identities = 21/61 (34%), Positives = 29/61 (47%)
 Frame = -2

Query: 518 SLSCLRTPALFVDRCTAPVKLPAWQCPRTGSRGSFKRRRAFPPRHHSARLERNTVRPPIL 339
           S+S ++     +DR  AP K P W     G+R   K     PP  HS ++E+   RP  L
Sbjct: 318 SISVMKADQAILDRLDAPTKAPNWPVGAEGNRPPAKIPVPLPP-SHSIKIEKTLSRPEKL 376

Query: 338 S 336
           S
Sbjct: 377 S 377


>UniRef50_Q4RRS5 Cluster: Chromosome 16 SCAF15002, whole genome
            shotgun sequence; n=4; Euteleostomi|Rep: Chromosome 16
            SCAF15002, whole genome shotgun sequence - Tetraodon
            nigroviridis (Green puffer)
          Length = 1278

 Score = 37.5 bits (83), Expect = 0.30
 Identities = 21/46 (45%), Positives = 27/46 (58%), Gaps = 2/46 (4%)
 Frame = -1

Query: 285  VVFQRRSRETT-PTYATPLMSP-YNARLESSSTGSSFPADSPKPVP 154
            V F RRS  TT PT      SP Y+A +  +ST +S+P+ SP P P
Sbjct: 1088 VSFSRRSSLTTSPTQGARQPSPSYHAHMSYASTAASYPSQSPSPPP 1133


>UniRef50_Q4HL63 Cluster: Lipoprotein, putative; n=11; Bacteria|Rep:
           Lipoprotein, putative - Campylobacter lari RM2100
          Length = 97

 Score = 37.5 bits (83), Expect = 0.30
 Identities = 21/40 (52%), Positives = 25/40 (62%)
 Frame = -1

Query: 144 VSLDSR*GQWESR*SIHARH*LDDEAFGYLKRVIVTPAVY 25
           +SLD    Q  SR +IHA   L D+ F YL+ VIVT AVY
Sbjct: 50  ISLDPSLRQLPSRYAIHAGRYLTDKEFRYLRTVIVTAAVY 89


>UniRef50_Q96F05 Cluster: Uncharacterized protein C11orf24
           precursor; n=6; Eutheria|Rep: Uncharacterized protein
           C11orf24 precursor - Homo sapiens (Human)
          Length = 449

 Score = 36.3 bits (80), Expect = 0.70
 Identities = 29/116 (25%), Positives = 51/116 (43%), Gaps = 7/116 (6%)
 Frame = -1

Query: 480 QMYRPSQTPRLAVSSNRITREF*TATSVSATSPLCTLGTKHRAPADIIDRAPLPPNR--- 310
           Q+ + S  PR A  +   TR    AT+ + +SP+ T  +  +        +P+PP R   
Sbjct: 194 QVPKSSALPRTATLATLATRAQTVATTANTSSPMSTRPSPSKHMPSDTAASPVPPMRPQA 253

Query: 309 ---VSNETMKVVVFQRRSRET-TPTYATPLMSPYNARLESSSTGSSFPADSPKPVP 154
              +S  ++   V    ++ T  P+  TP  +P    + ++   +  P  SP PVP
Sbjct: 254 QGPISQVSVDQPVVNTTNKSTPMPSNTTPEPAPTPTVVTTTKAQAREPTASPVPVP 309


>UniRef50_UPI0000E254D5 Cluster: PREDICTED: plectin 1; n=3;
           Amniota|Rep: PREDICTED: plectin 1 - Pan troglodytes
          Length = 4393

 Score = 35.5 bits (78), Expect = 1.2
 Identities = 24/65 (36%), Positives = 28/65 (43%)
 Frame = -2

Query: 506 LRTPALFVDRCTAPVKLPAWQCPRTGSRGSFKRRRAFPPRHHSARLERNTVRPPILSTAH 327
           LR  A F  R    +   A +C R G R S+ R R    R H   LER     P L+ A 
Sbjct: 125 LRDRAPFTSRTPVLLGTGAGECARVGMRASWLRPRCRCTRPHCGLLERRPGLTPGLAAAE 184

Query: 326 RFRPT 312
             RPT
Sbjct: 185 LPRPT 189


>UniRef50_A5ZYV6 Cluster: Putative uncharacterized protein; n=1;
           Ruminococcus obeum ATCC 29174|Rep: Putative
           uncharacterized protein - Ruminococcus obeum ATCC 29174
          Length = 114

 Score = 35.5 bits (78), Expect = 1.2
 Identities = 13/21 (61%), Positives = 14/21 (66%)
 Frame = -2

Query: 485 VDRCTAPVKLPAWQCPRTGSR 423
           +   TAPVKLP W CP  GSR
Sbjct: 51  LSEATAPVKLPVWHCPTAGSR 71


>UniRef50_A1UND9 Cluster: Putative secreted protein precursor; n=6;
           Mycobacterium|Rep: Putative secreted protein precursor -
           Mycobacterium sp. (strain KMS)
          Length = 156

 Score = 35.1 bits (77), Expect = 1.6
 Identities = 20/64 (31%), Positives = 29/64 (45%)
 Frame = -1

Query: 402 SVSATSPLCTLGTKHRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRETTPTYATPLMSP 223
           ++SA   +  L       AD  D  P+P NR+   T  V  +   +R+T+P Y    M  
Sbjct: 12  AISAAMAMGVLAAPAVGSADATDDYPIP-NRIMRTTCTVEQYMAAARDTSPVYYERYMID 70

Query: 222 YNAR 211
           YN R
Sbjct: 71  YNNR 74


>UniRef50_Q60QM7 Cluster: Putative uncharacterized protein CBG21754;
           n=1; Caenorhabditis briggsae|Rep: Putative
           uncharacterized protein CBG21754 - Caenorhabditis
           briggsae
          Length = 527

 Score = 35.1 bits (77), Expect = 1.6
 Identities = 28/103 (27%), Positives = 47/103 (45%)
 Frame = -1

Query: 459 TPRLAVSSNRITREF*TATSVSATSPLCTLGTKHRAPADIIDRAPLPPNRVSNETMKVVV 280
           TP +  ++N  T    T  +  AT+P  T     +    ++  AP PP   S  T+  ++
Sbjct: 105 TPAIVETTNATTTTPTTPKTTEATTP--TTEAPQKVSKLVVTPAP-PPTTTSVPTVTTLL 161

Query: 279 FQRRSRETTPTYATPLMSPYNARLESSSTGSSFPADSPKPVPL 151
               +  T+PT  +  M+P  +  E  ST SS  + +P P P+
Sbjct: 162 --PNNNNTSPTTNSTQMAPNTSATE--STTSSIASQTPPPTPV 200


>UniRef50_Q4PCA4 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 1238

 Score = 34.7 bits (76), Expect = 2.1
 Identities = 33/119 (27%), Positives = 53/119 (44%), Gaps = 2/119 (1%)
 Frame = -1

Query: 480 QMYRPSQTPRLAVSSNRITREF*TATSVSATSPL-CTLGTKHRAPADIIDRAPLPPNRVS 304
           QM+R    P++AV  +  TR     T  S T P+ C +   H + +D + R   PP R+ 
Sbjct: 510 QMHRSKSAPQIAVQDST-TRTDTARTKTSKTEPVECAVSDSH-SDSDEVQRPRTPPERIL 567

Query: 303 N-ETMKVVVFQRRSRETTPTYATPLMSPYNARLESSSTGSSFPADSPKPVPLAVVSLDS 130
           + +T +  V  + SR      A P     +A   +  T S+  A +    P   VS++S
Sbjct: 568 HAQTPRTGV--KASRVRAQRVAVPSAVKVSAMRVAVPTPSAKVAATRMRNPATSVSVES 624


>UniRef50_A5UR23 Cluster: Tetratricopeptide TPR_2 repeat protein;
           n=2; Roseiflexus|Rep: Tetratricopeptide TPR_2 repeat
           protein - Roseiflexus sp. RS-1
          Length = 435

 Score = 34.3 bits (75), Expect = 2.8
 Identities = 22/66 (33%), Positives = 32/66 (48%), Gaps = 3/66 (4%)
 Frame = -1

Query: 330 APLPPNRVSNETMKVVVFQRRSRETTPTYATPLMSPYNARLESS---STGSSFPADSPKP 160
           AP+ P +V  +  + V     + ETTP  A     P +A  ES+      ++ PAD P P
Sbjct: 224 APVSPTQVVEQPTEPVTAPTPAVETTPPAAEATPQPGDATPESTPGEQPTAAPPADQPTP 283

Query: 159 VPLAVV 142
           VP  V+
Sbjct: 284 VPAPVI 289


>UniRef50_A4LZ01 Cluster: Beta-ketoacyl synthase; n=2; cellular
           organisms|Rep: Beta-ketoacyl synthase - Geobacter
           bemidjiensis Bem
          Length = 2396

 Score = 34.3 bits (75), Expect = 2.8
 Identities = 19/40 (47%), Positives = 24/40 (60%)
 Frame = -1

Query: 207 ESSSTGSSFPADSPKPVPLAVVSLDSR*GQWESR*SIHAR 88
           ES +T S  PA   K  P+AVV LD+R G+W+   S  AR
Sbjct: 451 ESEATASPAPA---KGCPIAVVGLDARFGEWQDLTSFQAR 487


>UniRef50_UPI0000E81AF1 Cluster: PREDICTED: hypothetical protein;
           n=1; Gallus gallus|Rep: PREDICTED: hypothetical protein
           - Gallus gallus
          Length = 136

 Score = 33.5 bits (73), Expect = 4.9
 Identities = 27/100 (27%), Positives = 44/100 (44%), Gaps = 12/100 (12%)
 Frame = -1

Query: 417 F*TATSVSATSPLCTLGTKHRAPADIIDRAPLPPNR-VSNETMKVVVFQR-------RSR 262
           F T+ + +ATSP+ T     +    ++  AP  P+  V+    K +V          +  
Sbjct: 14  FSTSPAPTATSPVTTTVPSVQPVVKLVSAAPTAPSATVTGSVQKYIVVSLPPTAGDPKPT 73

Query: 261 ETTPTYATPLMSPYNARLESSSTG----SSFPADSPKPVP 154
            + PT   P +SP +A    ++T      S P DSP+P P
Sbjct: 74  TSVPTTPGPQLSPSSATASPAATAVTTPKSEPGDSPQPPP 113


>UniRef50_A5ZYV5 Cluster: Putative uncharacterized protein; n=7;
           Clostridiales|Rep: Putative uncharacterized protein -
           Ruminococcus obeum ATCC 29174
          Length = 96

 Score = 33.1 bits (72), Expect = 6.5
 Identities = 19/46 (41%), Positives = 22/46 (47%)
 Frame = +1

Query: 424 RDPVRGHCQAGSLTGAVHLSTNNAGVLRQLSEDRNLAWSKRAKAGL 561
           RDP  G CQ GSLTGAV     +      L  D N   S +A+  L
Sbjct: 15  RDPAVGQCQTGSLTGAVASERVSEAPKGSLRMDGNHPKSAKAEGSL 60


>UniRef50_A4RG52 Cluster: Putative uncharacterized protein; n=1;
           Magnaporthe grisea|Rep: Putative uncharacterized protein
           - Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 1269

 Score = 33.1 bits (72), Expect = 6.5
 Identities = 21/77 (27%), Positives = 40/77 (51%), Gaps = 1/77 (1%)
 Frame = -1

Query: 387 SPLCTLGTKHRAPADIIDRAPLPPNRVSNETMKVVVFQRRS-RETTPTYATPLMSPYNAR 211
           +P  T+ +  + P+ +    P+  N+ + E  + V  ++++  E TP  ATP++ P N  
Sbjct: 712 APQKTVDSLQKEPSPVNPPEPMILNQPNIEAPESVSDEQQAINEATPATATPVVEPEN-- 769

Query: 210 LESSSTGSSFPADSPKP 160
             S   G+  P+ SP+P
Sbjct: 770 --SFEKGAESPSSSPEP 784


>UniRef50_UPI0000DD7F3C Cluster: PREDICTED: hypothetical protein;
           n=1; Homo sapiens|Rep: PREDICTED: hypothetical protein -
           Homo sapiens
          Length = 496

 Score = 32.7 bits (71), Expect = 8.6
 Identities = 20/44 (45%), Positives = 24/44 (54%), Gaps = 2/44 (4%)
 Frame = -2

Query: 470 APVKLPAWQCPRTG--SRGSFKRRRAFPPRHHSARLERNTVRPP 345
           AP  LPA +  R G  +RG   RR    PR  SAR++  T RPP
Sbjct: 249 APPNLPAARSLRRGPGARGRAGRRGRSRPRLASARIKARTARPP 292


>UniRef50_Q4S9Z6 Cluster: Chromosome undetermined SCAF14693, whole
           genome shotgun sequence; n=2; Tetraodontidae|Rep:
           Chromosome undetermined SCAF14693, whole genome shotgun
           sequence - Tetraodon nigroviridis (Green puffer)
          Length = 125

 Score = 32.7 bits (71), Expect = 8.6
 Identities = 17/47 (36%), Positives = 27/47 (57%)
 Frame = -1

Query: 261 ETTPTYATPLMSPYNARLESSSTGSSFPADSPKPVPLAVVSLDSR*G 121
           + +P   TP +SP+++ L  SS+ S  P  SP P P AV+  + + G
Sbjct: 45  KASPEQDTPPVSPHSSLLSPSSSCSPPPFYSPPPSPTAVLFCEDKAG 91


>UniRef50_Q4QEU8 Cluster: Putative uncharacterized protein; n=3;
            Leishmania|Rep: Putative uncharacterized protein -
            Leishmania major
          Length = 1009

 Score = 32.7 bits (71), Expect = 8.6
 Identities = 33/105 (31%), Positives = 46/105 (43%), Gaps = 3/105 (2%)
 Frame = -1

Query: 480  QMYRPSQTPRLAVSSNRITREF*TATSVSATSPLCTLGTKHRAP-ADIIDRAPL-PPNRV 307
            Q+Y P   PRLA+SS+  +       S   T PL +  T   +P A  +  AP  PP  V
Sbjct: 778  QLYHPYAPPRLAISSHVSSVGAANFDSRFPTPPLPSPPTGFPSPMASPLHTAPAKPPLFV 837

Query: 306  SNETMKVVVFQRRSRETTPTYATPLMSPY-NARLESSSTGSSFPA 175
                 + +  +  SR   P+ A P   P   A    +S G +FPA
Sbjct: 838  GVPGYQPLRTRHESRAAWPSQAFPASLPAGKAPPYGTSAGYTFPA 882


>UniRef50_A4HFN4 Cluster: Putative uncharacterized protein; n=3;
           Leishmania|Rep: Putative uncharacterized protein -
           Leishmania braziliensis
          Length = 660

 Score = 32.7 bits (71), Expect = 8.6
 Identities = 23/75 (30%), Positives = 36/75 (48%), Gaps = 4/75 (5%)
 Frame = -2

Query: 584 LCVLNIWIKPAFALLLHARF---LSSLSCLRTPALFVDRCTAPVKLPAWQCPRTGSR-GS 417
           +C L + ++ A  +L        LS L  +   +  ++RC      P+  C RTG+R  S
Sbjct: 235 VCTLRVVLRDADLILFTVHLESVLSDLFAIEHYSRKLERCNTFDSQPSRVCHRTGARLSS 294

Query: 416 FKRRRAFPPRHHSAR 372
           F R  A PP++ S R
Sbjct: 295 FVRSSARPPQYLSHR 309


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 716,027,401
Number of Sequences: 1657284
Number of extensions: 15382106
Number of successful extensions: 44353
Number of sequences better than 10.0: 40
Number of HSP's better than 10.0 without gapping: 42025
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 44306
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 53305790091
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).