SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0091
         (727 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A5PLD0 Cluster: Zgc:165536 protein; n=12; Fungi/Metazoa...   118   2e-25
UniRef50_UPI0000D57947 Cluster: PREDICTED: hypothetical protein;...    80   5e-14
UniRef50_Q4P3R9 Cluster: Putative uncharacterized protein; n=3; ...    80   5e-14
UniRef50_O04892 Cluster: Cytochrome P450 like_TBP; n=10; Eukaryo...    76   1e-12
UniRef50_Q9AVH2 Cluster: Putative senescence-associated protein;...    73   7e-12
UniRef50_A4VF70 Cluster: Putative uncharacterized protein; n=1; ...    70   7e-11
UniRef50_Q7QQI2 Cluster: GLP_748_1200_211; n=1; Giardia lamblia ...    66   8e-10
UniRef50_A5K5F4 Cluster: Senescence-associated protein, putative...    62   2e-08
UniRef50_UPI00006A2901 Cluster: UPI00006A2901 related cluster; n...    61   2e-08
UniRef50_Q6QI74 Cluster: LRRG00134; n=6; Euteleostomi|Rep: LRRG0...    58   2e-07
UniRef50_Q7RN96 Cluster: Putative senescence-associated protein;...    58   2e-07
UniRef50_A4VF71 Cluster: Putative uncharacterized protein; n=1; ...    55   2e-06
UniRef50_Q6L6Z5 Cluster: RRNA intron-encoded endonuclease; n=3; ...    53   6e-06
UniRef50_Q3E811 Cluster: Uncharacterized protein YLR162W-A; n=47...    52   1e-05
UniRef50_A5B940 Cluster: Putative uncharacterized protein; n=1; ...    50   8e-05
UniRef50_Q7QQI1 Cluster: GLP_748_557_1225; n=1; Giardia lamblia ...    47   4e-04
UniRef50_Q14C49 Cluster: 4933429F08Rik protein; n=3; Euarchontog...    47   5e-04
UniRef50_A5AX63 Cluster: Putative uncharacterized protein; n=1; ...    44   0.003
UniRef50_UPI0000DA4670 Cluster: PREDICTED: hypothetical protein;...    42   0.021
UniRef50_A5LFT8 Cluster: Putative uncharacterized protein; n=2; ...    38   0.33 
UniRef50_Q4S9Z6 Cluster: Chromosome undetermined SCAF14693, whol...    36   1.0  
UniRef50_Q972E8 Cluster: Putative uncharacterized protein ST1183...    36   1.0  
UniRef50_Q54SH1 Cluster: Putative uncharacterized protein; n=1; ...    36   1.3  
UniRef50_A5ZYV6 Cluster: Putative uncharacterized protein; n=1; ...    35   1.8  
UniRef50_O74086 Cluster: Putative uncharacterized protein PHS003...    35   1.8  
UniRef50_UPI00015B5708 Cluster: PREDICTED: similar to ENSANGP000...    35   2.4  
UniRef50_UPI0000E254D5 Cluster: PREDICTED: plectin 1; n=3; Amnio...    35   2.4  
UniRef50_A4LZ01 Cluster: Beta-ketoacyl synthase; n=2; cellular o...    34   3.1  
UniRef50_A0JW68 Cluster: Diguanylate phosphodiesterase precursor...    34   3.1  
UniRef50_O04059 Cluster: Putative 3,4-dihydroxy-2-butanone kinas...    34   3.1  
UniRef50_A3EU22 Cluster: Superfamily I DNA and RNA helicase; n=1...    34   4.1  
UniRef50_Q0DV44 Cluster: Os03g0151000 protein; n=1; Oryza sativa...    34   4.1  
UniRef50_Q4PCA4 Cluster: Putative uncharacterized protein; n=1; ...    33   5.4  
UniRef50_P38968 Cluster: Protein transport protein SEC31; n=6; S...    33   5.4  
UniRef50_O57960 Cluster: Putative uncharacterized protein PH0221...    33   7.2  
UniRef50_UPI0000DD7F3C Cluster: PREDICTED: hypothetical protein;...    33   9.5  

>UniRef50_A5PLD0 Cluster: Zgc:165536 protein; n=12; Fungi/Metazoa
           group|Rep: Zgc:165536 protein - Danio rerio (Zebrafish)
           (Brachydanio rerio)
          Length = 55

 Score =  118 bits (283), Expect = 2e-25
 Identities = 50/55 (90%), Positives = 53/55 (96%)
 Frame = +3

Query: 21  MPRHLISDAHEWINEIPTVPIYYLAKPQPRERAWENQRGKKTLLSLTLVWHCKET 185
           MPRHLISDAHEW+NEIPTVP  YLAKPQPRERAW+NQRGKKTLLSLTLVWHC+ET
Sbjct: 1   MPRHLISDAHEWMNEIPTVPTCYLAKPQPRERAWQNQRGKKTLLSLTLVWHCEET 55


>UniRef50_UPI0000D57947 Cluster: PREDICTED: hypothetical protein;
           n=1; Tribolium castaneum|Rep: PREDICTED: hypothetical
           protein - Tribolium castaneum
          Length = 70

 Score = 80.2 bits (189), Expect = 5e-14
 Identities = 38/41 (92%), Positives = 39/41 (95%)
 Frame = -2

Query: 210 SPTYATPLMSPYNARLESSSTGSSFPADSPKPVPLAVVSLD 88
           SPTYATPLMSPYNARLESSSTGSSFPA+  KPVPLAVVSLD
Sbjct: 13  SPTYATPLMSPYNARLESSSTGSSFPANFSKPVPLAVVSLD 53



 Score = 35.9 bits (79), Expect = 1.0
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = -3

Query: 80  RDSGNLVNPFMRVTN 36
           RDSGNLVNPFMRVTN
Sbjct: 56  RDSGNLVNPFMRVTN 70


>UniRef50_Q4P3R9 Cluster: Putative uncharacterized protein; n=3;
           Dikarya|Rep: Putative uncharacterized protein - Ustilago
           maydis (Smut fungus)
          Length = 160

 Score = 80.2 bits (189), Expect = 5e-14
 Identities = 57/124 (45%), Positives = 64/124 (51%)
 Frame = -1

Query: 508 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHAGVLNGDERFRHVTTLH 329
           F PF   E+SVL E  LGHLRY LTDVPPQ NSPP +        V N D+ +  +T LH
Sbjct: 48  FYPFVLLEISVLHESPLGHLRYRLTDVPPQPNSPPDN--------VSNSDQAYMLLTPLH 99

Query: 328 AWNETPCARRYYRPRTASAQPSK**TMKVVVFQRRSRETISHLCYTSHVSLQCQTRVKLN 149
            W                       TM+VVVF RR     SHL YT HVS QCQTRVKLN
Sbjct: 100 -WISKE-------------------TMEVVVFHRRRS---SHLFYTLHVSSQCQTRVKLN 136

Query: 148 RVFF 137
              +
Sbjct: 137 HAAY 140



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = -3

Query: 647 MNAWLPQASYPCGNFSGTS 591
           MNAWLPQASYPCGNFSGTS
Sbjct: 1   MNAWLPQASYPCGNFSGTS 19


>UniRef50_O04892 Cluster: Cytochrome P450 like_TBP; n=10;
           Eukaryota|Rep: Cytochrome P450 like_TBP - Nicotiana
           tabacum (Common tobacco)
          Length = 530

 Score = 75.8 bits (178), Expect = 1e-12
 Identities = 61/129 (47%), Positives = 70/129 (54%)
 Frame = -2

Query: 432 MYRPSQTPRLAVSSNRITREF*TATSVSATSPLCTLGTKHRAPADIIDRAPLPPNRVSNE 253
           M RPSQTP L +SS RI  +              +LG+K R  A      PLP + +S  
Sbjct: 1   MCRPSQTPHLTMSSARIGLQ-------------ASLGSKKRGSA------PLPIHGISKI 41

Query: 252 Q*K*WFFSDDRAKRSPTYATPLMSPYNARLESSSTGSSFPADSPKPVPLAVVSLDSR*GQ 73
             K   F    +  +PTY TPL S +   LESSSTGSSFPADS KPVPL VVSLDSR   
Sbjct: 42  TLKVVVFHFRLS--APTYTTPLKSFHKVGLESSSTGSSFPADSAKPVPLVVVSLDSRQDS 99

Query: 72  WESR*SIHA 46
             S  SIHA
Sbjct: 100 GISL-SIHA 107


>UniRef50_Q9AVH2 Cluster: Putative senescence-associated protein;
           n=4; Eukaryota|Rep: Putative senescence-associated
           protein - Pisum sativum (Garden pea)
          Length = 282

 Score = 72.9 bits (171), Expect = 7e-12
 Identities = 37/52 (71%), Positives = 39/52 (75%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AVFSQSLCVLNIWIK 513
           GSKSNVAMNAWLPQASYPCGNFS TS  K   LKDR A  S+ + VL I IK
Sbjct: 99  GSKSNVAMNAWLPQASYPCGNFSDTSSFKFRSLKDRLATLSRFVFVLEIRIK 150



 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 46/110 (41%), Positives = 56/110 (50%)
 Frame = -1

Query: 463 ALGHLRYSLTDVPPQSNSPPGSVLEPDHAGVLNGDERFRHVTTLHAWNETPCARRYYRPR 284
           +LGHLRY LTDVPPQ NSPP +V  PD              T +  W +    R   RP 
Sbjct: 168 SLGHLRYLLTDVPPQPNSPPDNVFRPDRP------------TKVSLWIKKEGQR---RPP 212

Query: 283 TASAQPSK**TMKVVVFQRRSRETISHLCYTSHVSLQCQTRVKLNRVFFP 134
            +  + +   +  +  F   S    SHL YTS V  Q +TRVKLNRVFFP
Sbjct: 213 DSRNKLNNVKSSGISTFAVSS----SHLSYTSQVISQSRTRVKLNRVFFP 258



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 23/48 (47%), Positives = 31/48 (64%)
 Frame = -2

Query: 204 TYATPLMSPYNARLESSSTGSSFPADSPKPVPLAVVSLDSR*GQWESR 61
           +Y + ++S    R++ +     FPADS K VPL +VSLDSR GQWE R
Sbjct: 237 SYTSQVISQSRTRVKLNRV--FFPADSAKAVPLLLVSLDSRKGQWEFR 282


>UniRef50_A4VF70 Cluster: Putative uncharacterized protein; n=1;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 116

 Score = 69.7 bits (163), Expect = 7e-11
 Identities = 35/55 (63%), Positives = 41/55 (74%)
 Frame = +1

Query: 505 KTGLIQMFSTHRDCENTAYRSFSIKSF*QEVPEKLPQG*LACGSQAFIATLLFDP 669
           K  LI +FS + + E+ AYRSF+  SF  EV EKLPQG LACGSQ FI+TLLFDP
Sbjct: 37  KATLILIFSRNTNRESVAYRSFNFTSFKLEVSEKLPQGQLACGSQEFISTLLFDP 91



 Score = 38.7 bits (86), Expect = 0.14
 Identities = 21/35 (60%), Positives = 23/35 (65%)
 Frame = +2

Query: 404 RRGV*LGRYICQRITQVS*GQLSEDRNLAWSKRAK 508
           R GV LGR  CQ ITQ S  QLSE+ NL  +KR K
Sbjct: 3   RGGVCLGRNACQTITQASQVQLSENGNLTQNKRVK 37


>UniRef50_Q7QQI2 Cluster: GLP_748_1200_211; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_748_1200_211 - Giardia lamblia ATCC
           50803
          Length = 329

 Score = 66.1 bits (154), Expect = 8e-10
 Identities = 36/55 (65%), Positives = 37/55 (67%)
 Frame = -2

Query: 165 LESSSTGSSFPADSPKPVPLAVVSLDSR*GQWESR*SIHARH*LDDEAFGYLKRV 1
           LESSS GSS PA  P PVP A  S     GQW+ R SIHAR  L DEAFGYLKRV
Sbjct: 178 LESSSKGSSCPAGRPSPVPEAGGSRRRGSGQWDPRWSIHARRKLPDEAFGYLKRV 232


>UniRef50_A5K5F4 Cluster: Senescence-associated protein, putative;
           n=1; Plasmodium vivax|Rep: Senescence-associated
           protein, putative - Plasmodium vivax
          Length = 131

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 27/40 (67%), Positives = 32/40 (80%)
 Frame = -1

Query: 514 SQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSV 395
           + F PF+ +E+SVL+EL  GHLRY LTDVPPQSNSPP  V
Sbjct: 68  TSFSPFSLQEISVLSELVFGHLRYYLTDVPPQSNSPPDYV 107



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 21/26 (80%), Positives = 22/26 (84%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTS 591
           GSKS VA +AW PQASYPCGNFS TS
Sbjct: 9   GSKSYVARSAWQPQASYPCGNFSDTS 34


>UniRef50_UPI00006A2901 Cluster: UPI00006A2901 related cluster; n=1;
           Xenopus tropicalis|Rep: UPI00006A2901 UniRef100 entry -
           Xenopus tropicalis
          Length = 154

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 28/42 (66%), Positives = 30/42 (71%)
 Frame = -1

Query: 508 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 383
           F PF   E+SVL EL LGHLRY LTDVPPQ NSPP +V   D
Sbjct: 48  FYPFVLHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFHLD 89



 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 20/21 (95%), Positives = 21/21 (100%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGN 606
           GSKSNVAMNAWLPQASYPCG+
Sbjct: 9   GSKSNVAMNAWLPQASYPCGS 29


>UniRef50_Q6QI74 Cluster: LRRG00134; n=6; Euteleostomi|Rep:
           LRRG00134 - Rattus norvegicus (Rat)
          Length = 221

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 25/29 (86%), Positives = 26/29 (89%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*K 582
           GSKS+VAMNAW PQASYPCGNFS TSC K
Sbjct: 46  GSKSDVAMNAWPPQASYPCGNFSDTSCLK 74


>UniRef50_Q7RN96 Cluster: Putative senescence-associated protein;
           n=3; Eukaryota|Rep: Putative senescence-associated
           protein - Plasmodium yoelii yoelii
          Length = 205

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 34/72 (47%), Positives = 43/72 (59%), Gaps = 6/72 (8%)
 Frame = -1

Query: 592 LAKNSLY*RIDRPCFRSPYAY*TSGSSQ------FCPFAPREVSVLAELALGHLRYSLTD 431
           +AKN+   +   PC    +A+  S  S+      F PF+ +E+SVL EL  GHL Y LTD
Sbjct: 14  VAKNAWQPQASYPCGSIGHAFTFSTFSESRNQTSFSPFSLQEISVLFELVFGHLCYFLTD 73

Query: 430 VPPQSNSPPGSV 395
           VPPQSNSP G V
Sbjct: 74  VPPQSNSPSGYV 85



 Score = 39.1 bits (87), Expect = 0.11
 Identities = 16/20 (80%), Positives = 17/20 (85%)
 Frame = -3

Query: 665 SKSNVAMNAWLPQASYPCGN 606
           SKS VA NAW PQASYPCG+
Sbjct: 10  SKSYVAKNAWQPQASYPCGS 29


>UniRef50_A4VF71 Cluster: Putative uncharacterized protein; n=1;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 70

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 27/35 (77%), Positives = 29/35 (82%)
 Frame = -2

Query: 177 YNARLESSSTGSSFPADSPKPVPLAVVSLDSR*GQ 73
           +  RLESSSTGSSFPAD  KPVPLA+ SLDSR GQ
Sbjct: 19  HKVRLESSSTGSSFPADYSKPVPLAMGSLDSRQGQ 53


>UniRef50_Q6L6Z5 Cluster: RRNA intron-encoded endonuclease; n=3;
           Thermoproteaceae|Rep: RRNA intron-encoded endonuclease -
           Thermoproteus sp. IC-061
          Length = 234

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 22/46 (47%), Positives = 29/46 (63%)
 Frame = +3

Query: 39  SDAHEWINEIPTVPIYYLAKPQPRERAWENQRGKKTLLSLTLVWHC 176
           S  HEWINE+PTVP    A P P  ++W+ +RG+K+L S T    C
Sbjct: 177 SGVHEWINEVPTVPARGPANPPPGAQSWDPRRGEKSLWSFTAACRC 222


>UniRef50_Q3E811 Cluster: Uncharacterized protein YLR162W-A; n=47;
           Eukaryota|Rep: Uncharacterized protein YLR162W-A -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 62

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 24/34 (70%), Positives = 25/34 (73%)
 Frame = -1

Query: 508 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSP 407
           F PF   E+SVL E  LGHLRY LTDVPPQ NSP
Sbjct: 14  FYPFVLLEISVLHESPLGHLRYRLTDVPPQPNSP 47


>UniRef50_A5B940 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 108

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 23/40 (57%), Positives = 27/40 (67%)
 Frame = -1

Query: 514 SQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSV 395
           + F  F   E+ VL +L LGHLRY LTDV PQ NSPP +V
Sbjct: 44  TSFYHFVLHEIFVLVKLILGHLRYLLTDVSPQPNSPPDNV 83


>UniRef50_Q7QQI1 Cluster: GLP_748_557_1225; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_748_557_1225 - Giardia lamblia ATCC
           50803
          Length = 222

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 24/41 (58%), Positives = 25/41 (60%)
 Frame = +2

Query: 53  MD*RDSHCPYLLSSETTAKGTGLGESAGKEDPVELDSSLAL 175
           MD R SHCP     E  A GTG G  AG+EDP ELDSS  L
Sbjct: 1   MDQRGSHCPEPRLREPPASGTGEGRPAGQEDPFELDSSPGL 41


>UniRef50_Q14C49 Cluster: 4933429F08Rik protein; n=3;
           Euarchontoglires|Rep: 4933429F08Rik protein - Mus
           musculus (Mouse)
          Length = 29

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 647 MNAWLPQASYPCGNFSGTSC*K 582
           MNAW PQASYPCGNFS TSC K
Sbjct: 1   MNAWPPQASYPCGNFSDTSCLK 22


>UniRef50_A5AX63 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 421

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 17/24 (70%), Positives = 20/24 (83%)
 Frame = +3

Query: 30  HLISDAHEWINEIPTVPIYYLAKP 101
           HLISDAHEWIN+ PT+ +YY  KP
Sbjct: 398 HLISDAHEWINKNPTILVYYPTKP 421


>UniRef50_UPI0000DA4670 Cluster: PREDICTED: hypothetical protein;
           n=1; Rattus norvegicus|Rep: PREDICTED: hypothetical
           protein - Rattus norvegicus
          Length = 440

 Score = 41.5 bits (93), Expect = 0.021
 Identities = 15/18 (83%), Positives = 16/18 (88%)
 Frame = -3

Query: 431 CTAPVKLPAWQCPRTGSR 378
           CTAPVKLP W CPR+GSR
Sbjct: 75  CTAPVKLPTWHCPRSGSR 92



 Score = 33.5 bits (73), Expect = 5.4
 Identities = 15/16 (93%), Positives = 16/16 (100%)
 Frame = -2

Query: 669 RIKKQRRYERLAATSQ 622
           RIKK+RRYERLAATSQ
Sbjct: 55  RIKKRRRYERLAATSQ 70


>UniRef50_A5LFT8 Cluster: Putative uncharacterized protein; n=2;
           Streptococcus pneumoniae|Rep: Putative uncharacterized
           protein - Streptococcus pneumoniae SP3-BS71
          Length = 44

 Score = 37.5 bits (83), Expect = 0.33
 Identities = 19/34 (55%), Positives = 22/34 (64%)
 Frame = +1

Query: 415 LTGAVHLSKNNAGVLRPAQRGQKPRVEQKGKTGL 516
           + GA HL  +NA VLR A   QK  VEQKGK+ L
Sbjct: 1   MAGAAHLLNDNADVLRGAHGEQKSPVEQKGKSPL 34


>UniRef50_Q4S9Z6 Cluster: Chromosome undetermined SCAF14693, whole
           genome shotgun sequence; n=2; Tetraodontidae|Rep:
           Chromosome undetermined SCAF14693, whole genome shotgun
           sequence - Tetraodon nigroviridis (Green puffer)
          Length = 125

 Score = 35.9 bits (79), Expect = 1.0
 Identities = 19/51 (37%), Positives = 29/51 (56%)
 Frame = -2

Query: 228 DDRAKRSPTYATPLMSPYNARLESSSTGSSFPADSPKPVPLAVVSLDSR*G 76
           ++  K SP   TP +SP+++ L  SS+ S  P  SP P P AV+  + + G
Sbjct: 41  EEGGKASPEQDTPPVSPHSSLLSPSSSCSPPPFYSPPPSPTAVLFCEDKAG 91


>UniRef50_Q972E8 Cluster: Putative uncharacterized protein ST1183;
           n=1; Sulfolobus tokodaii|Rep: Putative uncharacterized
           protein ST1183 - Sulfolobus tokodaii
          Length = 117

 Score = 35.9 bits (79), Expect = 1.0
 Identities = 24/57 (42%), Positives = 27/57 (47%), Gaps = 2/57 (3%)
 Frame = -1

Query: 559 RPCFR--SPYAY*TSGSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSV 395
           RP FR  +PY +  S  + FCP   R  SV  E   G   Y    VPPQ N PP  V
Sbjct: 8   RPRFRVGTPY-FGGSRQAGFCPCTLRRRSVPPEPTFGLPCYLFAGVPPQPNRPPDDV 63


>UniRef50_Q54SH1 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 1346

 Score = 35.5 bits (78), Expect = 1.3
 Identities = 31/113 (27%), Positives = 54/113 (47%), Gaps = 4/113 (3%)
 Frame = -2

Query: 420 SQTPRLAVSSNRITREF*TATSVSAT---SPLCTLGTKHRAPADIIDRAPLPPNRVSNEQ 250
           S TP+ +++ NR++  F   T+ S+T   SPL +  +     +   +R     N+V +  
Sbjct: 316 SLTPQKSLTPNRLSGTFPRTTTSSSTPTSSPLRSTSSTTTTSSSTPNRLSSTINKVVSSS 375

Query: 249 *K*WFFSDDRAKRSPTY-ATPLMSPYNARLESSSTGSSFPADSPKPVPLAVVS 94
                 S   +  SPT  ATPL     ++L S+++ SS  + +P   PL+  S
Sbjct: 376 PS----STSSSSSSPTRSATPLPPTSTSKLSSTTSSSSSSSSTPNKTPLSTRS 424


>UniRef50_A5ZYV6 Cluster: Putative uncharacterized protein; n=1;
           Ruminococcus obeum ATCC 29174|Rep: Putative
           uncharacterized protein - Ruminococcus obeum ATCC 29174
          Length = 114

 Score = 35.1 bits (77), Expect = 1.8
 Identities = 13/17 (76%), Positives = 13/17 (76%)
 Frame = -3

Query: 428 TAPVKLPAWQCPRTGSR 378
           TAPVKLP W CP  GSR
Sbjct: 55  TAPVKLPVWHCPTAGSR 71


>UniRef50_O74086 Cluster: Putative uncharacterized protein PHS003;
           n=1; Pyrococcus horikoshii|Rep: Putative uncharacterized
           protein PHS003 - Pyrococcus horikoshii
          Length = 52

 Score = 35.1 bits (77), Expect = 1.8
 Identities = 18/34 (52%), Positives = 20/34 (58%)
 Frame = +1

Query: 409 GSLTGAVHLSKNNAGVLRPAQRGQKPRVEQKGKT 510
           GSL GA    K   G LR AQ GQ+  VE KGK+
Sbjct: 2   GSLAGAARPRKGIGGALRSAQAGQESAVECKGKS 35


>UniRef50_UPI00015B5708 Cluster: PREDICTED: similar to
           ENSANGP00000005626; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to ENSANGP00000005626 - Nasonia
           vitripennis
          Length = 1896

 Score = 34.7 bits (76), Expect = 2.4
 Identities = 25/84 (29%), Positives = 36/84 (42%), Gaps = 9/84 (10%)
 Frame = -2

Query: 276 PPNRVSNEQ*K*WFFSDD-------RAKRSPTYATPLMSPYNARLESSSTGS--SFPADS 124
           PPN  SN   + W  S+        R   +P  ++P  S Y+    SSS+ S  S PA+ 
Sbjct: 155 PPNSTSNNSGRCWPQSEQLVGGGSRRNNGNPNSSSPASSSYSTSSSSSSSSSSASLPAEQ 214

Query: 123 PKPVPLAVVSLDSR*GQWESR*SI 52
           P      V S+  +  QW    S+
Sbjct: 215 PNAASAVVPSVPRQLAQWTKHQSL 238


>UniRef50_UPI0000E254D5 Cluster: PREDICTED: plectin 1; n=3;
           Amniota|Rep: PREDICTED: plectin 1 - Pan troglodytes
          Length = 4393

 Score = 34.7 bits (76), Expect = 2.4
 Identities = 24/65 (36%), Positives = 28/65 (43%)
 Frame = -3

Query: 461 LRTPALFFDRCTAPVKLPAWQCPRTGSRGSFKRRRAFPPRHHSARLERNTVRPPILSTAH 282
           LR  A F  R    +   A +C R G R S+ R R    R H   LER     P L+ A 
Sbjct: 125 LRDRAPFTSRTPVLLGTGAGECARVGMRASWLRPRCRCTRPHCGLLERRPGLTPGLAAAE 184

Query: 281 RFRPT 267
             RPT
Sbjct: 185 LPRPT 189


>UniRef50_A4LZ01 Cluster: Beta-ketoacyl synthase; n=2; cellular
           organisms|Rep: Beta-ketoacyl synthase - Geobacter
           bemidjiensis Bem
          Length = 2396

 Score = 34.3 bits (75), Expect = 3.1
 Identities = 19/40 (47%), Positives = 24/40 (60%)
 Frame = -2

Query: 162 ESSSTGSSFPADSPKPVPLAVVSLDSR*GQWESR*SIHAR 43
           ES +T S  PA   K  P+AVV LD+R G+W+   S  AR
Sbjct: 451 ESEATASPAPA---KGCPIAVVGLDARFGEWQDLTSFQAR 487


>UniRef50_A0JW68 Cluster: Diguanylate phosphodiesterase precursor;
           n=1; Arthrobacter sp. FB24|Rep: Diguanylate
           phosphodiesterase precursor - Arthrobacter sp. (strain
           FB24)
          Length = 410

 Score = 34.3 bits (75), Expect = 3.1
 Identities = 21/72 (29%), Positives = 33/72 (45%)
 Frame = -2

Query: 420 SQTPRLAVSSNRITREF*TATSVSATSPLCTLGTKHRAPADIIDRAPLPPNRVSNEQ*K* 241
           +++P     + R+ R F T T ++A  P+C LGT     A+ + R    P R  ++    
Sbjct: 148 AESPAELEITTRLDRLFATRTLITAFQPICHLGTGEVVGAEALTRFVSAPFRSPDQ---- 203

Query: 240 WFFSDDRAKRSP 205
           WF   D   R P
Sbjct: 204 WFIEADSIGRGP 215


>UniRef50_O04059 Cluster: Putative 3,4-dihydroxy-2-butanone kinase;
           n=12; Magnoliophyta|Rep: Putative
           3,4-dihydroxy-2-butanone kinase - Solanum lycopersicum
           (Tomato) (Lycopersicon esculentum)
          Length = 594

 Score = 34.3 bits (75), Expect = 3.1
 Identities = 19/57 (33%), Positives = 25/57 (43%)
 Frame = -3

Query: 461 LRTPALFFDRCTAPVKLPAWQCPRTGSRGSFKRRRAFPPRHHSARLERNTVRPPILS 291
           ++      DR  AP K P W     G+R   K     PP  HS ++E+   RP  LS
Sbjct: 322 MKADQAILDRLDAPTKAPNWPVGAEGNRPPAKIPVPLPP-SHSIKIEKTLSRPEKLS 377


>UniRef50_A3EU22 Cluster: Superfamily I DNA and RNA helicase; n=1;
           Leptospirillum sp. Group II UBA|Rep: Superfamily I DNA
           and RNA helicase - Leptospirillum sp. Group II UBA
          Length = 746

 Score = 33.9 bits (74), Expect = 4.1
 Identities = 24/63 (38%), Positives = 27/63 (42%)
 Frame = -1

Query: 562 DRPCFRSPYAY*TSGSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 383
           DRP FR      T  S Q     PR+V     LA      SL  VP +  SPP  VL P+
Sbjct: 640 DRPVFRPE----TPVSRQTSELPPRKVFPPPSLAPSRPATSLRSVPEKRTSPPTEVLRPE 695

Query: 382 HAG 374
             G
Sbjct: 696 WIG 698


>UniRef50_Q0DV44 Cluster: Os03g0151000 protein; n=1; Oryza sativa
           (japonica cultivar-group)|Rep: Os03g0151000 protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 113

 Score = 33.9 bits (74), Expect = 4.1
 Identities = 21/53 (39%), Positives = 25/53 (47%)
 Frame = -3

Query: 458 RTPALFFDRCTAPVKLPAWQCPRTGSRGSFKRRRAFPPRHHSARLERNTVRPP 300
           R+P L   R   PV       P T  R S +RRR+ PP  H+ R  R   RPP
Sbjct: 15  RSPPLPHQRSPPPVSSSPLPAPATDGRSSARRRRS-PPIPHACR-RREIERPP 65


>UniRef50_Q4PCA4 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 1238

 Score = 33.5 bits (73), Expect = 5.4
 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 1/63 (1%)
 Frame = -2

Query: 435 QMYRPSQTPRLAVSSNRITREF*TATSVSATSPL-CTLGTKHRAPADIIDRAPLPPNRVS 259
           QM+R    P++AV  +  TR     T  S T P+ C +   H + +D + R   PP R+ 
Sbjct: 510 QMHRSKSAPQIAVQDST-TRTDTARTKTSKTEPVECAVSDSH-SDSDEVQRPRTPPERIL 567

Query: 258 NEQ 250
           + Q
Sbjct: 568 HAQ 570


>UniRef50_P38968 Cluster: Protein transport protein SEC31; n=6;
            Saccharomycetales|Rep: Protein transport protein SEC31 -
            Saccharomyces cerevisiae (Baker's yeast)
          Length = 1273

 Score = 33.5 bits (73), Expect = 5.4
 Identities = 23/85 (27%), Positives = 37/85 (43%), Gaps = 2/85 (2%)
 Frame = -1

Query: 628  KPVIPVVTFLAPLAKNSLY*RIDRPCFRSPYAY*TSGSSQFCPFAPREVSVLAELALGHL 449
            KP +P  T  AP+     Y    +P   SP+   T+ S++   FAP   +  A   +   
Sbjct: 808  KPYVPATTTSAPVHTEGKYAPPSQPSMASPFVNKTNSSTRLNSFAP-PPNPYATATVPAT 866

Query: 448  RYSLTDVPPQSNSP--PGSVLEPDH 380
              S T +P  + +P  PG  +  D+
Sbjct: 867  NVSTTSIPQNTFAPIQPGMPIMGDY 891


>UniRef50_O57960 Cluster: Putative uncharacterized protein PH0221;
           n=2; Pyrococcus|Rep: Putative uncharacterized protein
           PH0221 - Pyrococcus horikoshii
          Length = 235

 Score = 33.1 bits (72), Expect = 7.2
 Identities = 22/49 (44%), Positives = 24/49 (48%)
 Frame = -2

Query: 147 GSSFPADSPKPVPLAVVSLDSR*GQWESR*SIHARH*LDDEAFGYLKRV 1
           GSS P   P     A VS     GQ   R +IHA   L D+ F YLKRV
Sbjct: 2   GSSLPTGGPWHARQAEVSPGPGRGQRGPRYAIHAGRHLTDKEFRYLKRV 50


>UniRef50_UPI0000DD7F3C Cluster: PREDICTED: hypothetical protein;
           n=1; Homo sapiens|Rep: PREDICTED: hypothetical protein -
           Homo sapiens
          Length = 496

 Score = 32.7 bits (71), Expect = 9.5
 Identities = 20/44 (45%), Positives = 24/44 (54%), Gaps = 2/44 (4%)
 Frame = -3

Query: 425 APVKLPAWQCPRTG--SRGSFKRRRAFPPRHHSARLERNTVRPP 300
           AP  LPA +  R G  +RG   RR    PR  SAR++  T RPP
Sbjct: 249 APPNLPAARSLRRGPGARGRAGRRGRSRPRLASARIKARTARPP 292


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 766,942,452
Number of Sequences: 1657284
Number of extensions: 16487418
Number of successful extensions: 44907
Number of sequences better than 10.0: 36
Number of HSP's better than 10.0 without gapping: 42744
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 44884
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 59090914597
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).