SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0014
         (389 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI0000E48738 Cluster: PREDICTED: similar to fibropelli...    56   2e-07
UniRef50_UPI0000E49045 Cluster: PREDICTED: similar to ankyrin 2,...    53   2e-06
UniRef50_UPI0000E49762 Cluster: PREDICTED: hypothetical protein;...    43   0.002
UniRef50_UPI0000E46A20 Cluster: PREDICTED: hypothetical protein;...    38   0.052
UniRef50_A7S3Y3 Cluster: Predicted protein; n=2; Nematostella ve...    35   0.49 
UniRef50_A5DV45 Cluster: Putative uncharacterized protein; n=1; ...    34   1.1  
UniRef50_UPI0000ECA1B9 Cluster: Serine/arginine repetitive matri...    32   3.4  
UniRef50_Q12E06 Cluster: Alcohol dehydrogenase GroES-like; n=2; ...    32   4.5  
UniRef50_A0R582 Cluster: Probable conserved transmembrane protei...    32   4.5  
UniRef50_Q9VYA4 Cluster: CG11164-PA; n=3; Sophophora|Rep: CG1116...    31   6.0  
UniRef50_Q7S1S2 Cluster: Putative uncharacterized protein NCU077...    31   6.0  
UniRef50_Q8IQX0 Cluster: CG32537-PA; n=4; Sophophora|Rep: CG3253...    31   7.9  
UniRef50_Q6FQM3 Cluster: Similarities with sp|P34217 Saccharomyc...    31   7.9  

>UniRef50_UPI0000E48738 Cluster: PREDICTED: similar to fibropellin
           III, partial; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to fibropellin III, partial -
           Strongylocentrotus purpuratus
          Length = 288

 Score = 56.0 bits (129), Expect = 2e-07
 Identities = 25/54 (46%), Positives = 37/54 (68%)
 Frame = +2

Query: 5   LKGSRVIISEFLTKSRHDVFLEARSHFGVKRCWTTDGKIIVLLPDNKRSKIEQM 166
           LKGS + I E LTK+  D+F  A+ H  VK  WT+DG++IVLLP  + + I+++
Sbjct: 225 LKGSGIGIDEALTKTNQDLFYAAKQHEKVKEAWTSDGRVIVLLPATRGNTIKRV 278


>UniRef50_UPI0000E49045 Cluster: PREDICTED: similar to ankyrin
            2,3/unc44, partial; n=3; Strongylocentrotus
            purpuratus|Rep: PREDICTED: similar to ankyrin 2,3/unc44,
            partial - Strongylocentrotus purpuratus
          Length = 2259

 Score = 53.2 bits (122), Expect = 2e-06
 Identities = 24/53 (45%), Positives = 35/53 (66%)
 Frame = +2

Query: 5    LKGSRVIISEFLTKSRHDVFLEARSHFGVKRCWTTDGKIIVLLPDNKRSKIEQ 163
            LKGS + I E LTK+  D+   A+ H  VK  WT+DG++IVLLP  + + I++
Sbjct: 2207 LKGSGIGIDEALTKTNQDLLYAAKQHEKVKEAWTSDGRVIVLLPATRGNTIKR 2259


>UniRef50_UPI0000E49762 Cluster: PREDICTED: hypothetical protein;
           n=1; Strongylocentrotus purpuratus|Rep: PREDICTED:
           hypothetical protein - Strongylocentrotus purpuratus
          Length = 257

 Score = 42.7 bits (96), Expect = 0.002
 Identities = 19/54 (35%), Positives = 31/54 (57%)
 Frame = +2

Query: 5   LKGSRVIISEFLTKSRHDVFLEARSHFGVKRCWTTDGKIIVLLPDNKRSKIEQM 166
           LK + + I+E LTK  +D+  + RS   V   W+ DG+I V L  N  + I+++
Sbjct: 194 LKNTGISINEDLTKPNYDILKQTRSSSNVTAAWSQDGRIFVTLASNSGTNIKKL 247


>UniRef50_UPI0000E46A20 Cluster: PREDICTED: hypothetical protein;
           n=1; Strongylocentrotus purpuratus|Rep: PREDICTED:
           hypothetical protein - Strongylocentrotus purpuratus
          Length = 242

 Score = 38.3 bits (85), Expect = 0.052
 Identities = 20/51 (39%), Positives = 27/51 (52%)
 Frame = +2

Query: 5   LKGSRVIISEFLTKSRHDVFLEARSHFGVKRCWTTDGKIIVLLPDNKRSKI 157
           L G R  I E LTK+  D+    R+   VK  WT DG+I +   +NK+  I
Sbjct: 183 LAGKRKSIQEDLTKANQDLLAHVRTSEKVKAAWTRDGRIPMTDKNNKKHLI 233


>UniRef50_A7S3Y3 Cluster: Predicted protein; n=2; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 262

 Score = 35.1 bits (77), Expect = 0.49
 Identities = 20/60 (33%), Positives = 29/60 (48%)
 Frame = +2

Query: 8   KGSRVIISEFLTKSRHDVFLEARSHFGVKRCWTTDGKIIVLLPDNKRSKIEQMFELQHLK 187
           K  ++ ++E LTK R D      S   + + WT DG I V L  +K    E +  L+ LK
Sbjct: 193 KKDKLRVNEDLTKGRLDAIKAINSKLDIYKLWTIDGTIHVRLNKDKDKAKEIIHSLRQLK 252


>UniRef50_A5DV45 Cluster: Putative uncharacterized protein; n=1;
            Lodderomyces elongisporus NRRL YB-4239|Rep: Putative
            uncharacterized protein - Lodderomyces elongisporus
            (Yeast) (Saccharomyces elongisporus)
          Length = 1238

 Score = 33.9 bits (74), Expect = 1.1
 Identities = 15/54 (27%), Positives = 27/54 (50%)
 Frame = +2

Query: 128  LLPDNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDEPRRHQNQRQSEK 289
            LLP N   ++ QM  +  L   FP +Q+ Q   Q   +   + ++ Q Q+Q ++
Sbjct: 1134 LLPVNHMQQLRQMPHIPQLSNHFPHSQQQQHQQQQQQQQQQQQQQQQQQQQQQQ 1187


>UniRef50_UPI0000ECA1B9 Cluster: Serine/arginine repetitive matrix
           protein 1.; n=1; Gallus gallus|Rep: Serine/arginine
           repetitive matrix protein 1. - Gallus gallus
          Length = 553

 Score = 32.3 bits (70), Expect = 3.4
 Identities = 16/54 (29%), Positives = 25/54 (46%)
 Frame = +2

Query: 143 KRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDEPRRHQNQRQSEKSARGR 304
           + SK E+  E +  + + P+  K++   +S   SH  PRR    R    S R R
Sbjct: 143 RNSKKEREKEKEKTRQRSPTRSKSRSRSRSRSPSHSRPRRRHRSRSRSYSPRRR 196


>UniRef50_Q12E06 Cluster: Alcohol dehydrogenase GroES-like; n=2;
           Bacteria|Rep: Alcohol dehydrogenase GroES-like -
           Polaromonas sp. (strain JS666 / ATCC BAA-500)
          Length = 346

 Score = 31.9 bits (69), Expect = 4.5
 Identities = 16/36 (44%), Positives = 24/36 (66%), Gaps = 2/36 (5%)
 Frame = -3

Query: 204 AEGNLVFRC*SSNICSILLRLLSGRRT--IIFPSVV 103
           A G LV R  ++ +C   LR+L+GR+T  + FPSV+
Sbjct: 23  APGELVLRVRAAMVCGTDLRILTGRKTKGVRFPSVI 58


>UniRef50_A0R582 Cluster: Probable conserved transmembrane protein
           rich in alanine; n=2; Mycobacterium|Rep: Probable
           conserved transmembrane protein rich in alanine -
           Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)
          Length = 516

 Score = 31.9 bits (69), Expect = 4.5
 Identities = 14/35 (40%), Positives = 20/35 (57%)
 Frame = +2

Query: 191 KFPSAQKAQGAPQSSGKSHDEPRRHQNQRQSEKSA 295
           +FPS    Q  PQ + +  DEPRR + +R  E+ A
Sbjct: 222 RFPSQPTPQPGPQFTPQPSDEPRRRRRRRLDEEQA 256


>UniRef50_Q9VYA4 Cluster: CG11164-PA; n=3; Sophophora|Rep:
           CG11164-PA - Drosophila melanogaster (Fruit fly)
          Length = 340

 Score = 31.5 bits (68), Expect = 6.0
 Identities = 15/38 (39%), Positives = 24/38 (63%)
 Frame = -1

Query: 263 AVLVRHEISQMTEELLALFEPRETWFSDAEVQTSVQSY 150
           A+ + H   +M E L+A  EPR +WF D+EV ++ + Y
Sbjct: 63  ALFITHPDGRMME-LVAFTEPRRSWFVDSEVCSNGRIY 99


>UniRef50_Q7S1S2 Cluster: Putative uncharacterized protein
           NCU07756.1; n=2; Sordariomycetes|Rep: Putative
           uncharacterized protein NCU07756.1 - Neurospora crassa
          Length = 180

 Score = 31.5 bits (68), Expect = 6.0
 Identities = 14/57 (24%), Positives = 30/57 (52%), Gaps = 1/57 (1%)
 Frame = -1

Query: 335 FKIPPYYFRRVVLLPISR-SAADFGAVLVRHEISQMTEELLALFEPRETWFSDAEVQ 168
           FK+ P+   +   +   R + AD  A+L +  +++     L +++P++TWF  +  Q
Sbjct: 22  FKLAPFAAMQTRPIQTERLTPADEAAILAKQRLNRPVSPHLEIYDPKQTWFGGSAWQ 78


>UniRef50_Q8IQX0 Cluster: CG32537-PA; n=4; Sophophora|Rep:
           CG32537-PA - Drosophila melanogaster (Fruit fly)
          Length = 347

 Score = 31.1 bits (67), Expect = 7.9
 Identities = 18/54 (33%), Positives = 25/54 (46%)
 Frame = +2

Query: 137 DNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDEPRRHQNQRQSEKSAR 298
           D+K  KIE+ +++Q  K K     KA      S   H    R Q  +QSE+  R
Sbjct: 241 DSKGQKIERCYDVQARKAK-TRKTKASSTRHPSSSVHKRKPRSQQSQQSEQEQR 293


>UniRef50_Q6FQM3 Cluster: Similarities with sp|P34217 Saccharomyces
           cerevisiae YBL051c; n=1; Candida glabrata|Rep:
           Similarities with sp|P34217 Saccharomyces cerevisiae
           YBL051c - Candida glabrata (Yeast) (Torulopsis glabrata)
          Length = 604

 Score = 31.1 bits (67), Expect = 7.9
 Identities = 16/54 (29%), Positives = 28/54 (51%)
 Frame = +2

Query: 128 LLPDNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDEPRRHQNQRQSEK 289
           +LP  +R +IE+   L+H   K   AQ  Q   Q   +   +  +HQ+Q+Q ++
Sbjct: 144 VLPQEERERIERERRLKHQNQK--KAQWKQQQQQQQQQQQQQQHQHQHQQQQQQ 195


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 373,528,115
Number of Sequences: 1657284
Number of extensions: 6845215
Number of successful extensions: 21329
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 20801
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 21325
length of database: 575,637,011
effective HSP length: 91
effective length of database: 424,824,167
effective search space used: 16143318346
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).