SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0037
         (740 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI00015B4C08 Cluster: PREDICTED: similar to CG2534-PB;...    58   3e-07
UniRef50_UPI0000D56031 Cluster: PREDICTED: similar to CG2534-PA,...    56   9e-07
UniRef50_Q95TT5 Cluster: LD24616p; n=6; Diptera|Rep: LD24616p - ...    50   6e-05
UniRef50_Q17CZ0 Cluster: Afadin; n=3; Culicidae|Rep: Afadin - Ae...    49   1e-04
UniRef50_Q4YBB2 Cluster: Putative uncharacterized protein; n=1; ...    43   0.007
UniRef50_A7SV26 Cluster: Predicted protein; n=1; Nematostella ve...    41   0.028
UniRef50_Q4REG5 Cluster: Chromosome 10 SCAF15123, whole genome s...    40   0.049
UniRef50_Q32RI6 Cluster: Putative uncharacterized protein orf115...    40   0.064
UniRef50_Q4X807 Cluster: Putative uncharacterized protein; n=1; ...    38   0.26 
UniRef50_Q6ZTU1 Cluster: CDNA FLJ44225 fis, clone THYMU3006168; ...    38   0.34 
UniRef50_A6NLZ5 Cluster: Uncharacterized protein ENSP00000371562...    37   0.45 
UniRef50_Q4XP80 Cluster: Putative uncharacterized protein; n=1; ...    37   0.60 
UniRef50_Q64239 Cluster: 1st Met is at position 21; n=1; Mus sp....    36   0.79 
UniRef50_UPI0000E48CF0 Cluster: PREDICTED: similar to abc transp...    36   1.0  
UniRef50_Q5TIG5 Cluster: Myeloid/lymphoid or mixed-lineage leuke...    36   1.0  
UniRef50_P55196 Cluster: Afadin; n=26; Amniota|Rep: Afadin - Hom...    36   1.0  
UniRef50_Q64238 Cluster: Orf2 5' of EpoR protein; n=1; Mus sp.|R...    36   1.4  
UniRef50_A7TBF1 Cluster: Predicted protein; n=1; Nematostella ve...    36   1.4  
UniRef50_UPI0000DBFC45 Cluster: UPI0000DBFC45 related cluster; n...    35   1.8  
UniRef50_Q4T539 Cluster: Chromosome undetermined SCAF9438, whole...    35   1.8  
UniRef50_Q4SA46 Cluster: Chromosome 12 SCAF14692, whole genome s...    35   2.4  
UniRef50_Q62097 Cluster: Mus musculus ORFs (putative primordial ...    35   2.4  
UniRef50_Q6ZUP2 Cluster: CDNA FLJ43495 fis, clone PEBLM2000338; ...    35   2.4  
UniRef50_Q47ML7 Cluster: Putative uncharacterized protein; n=1; ...    34   3.2  
UniRef50_Q75J12 Cluster: Putative uncharacterized protein OSJNBb...    34   3.2  
UniRef50_Q19TX3 Cluster: NADH dehydrogenase subunit 6; n=1; Idot...    34   3.2  
UniRef50_Q6ZVA9 Cluster: CDNA FLJ42813 fis, clone BRCAN2012355; ...    34   3.2  
UniRef50_Q55QY7 Cluster: Putative uncharacterized protein; n=2; ...    34   3.2  
UniRef50_UPI0000DD78AE Cluster: PREDICTED: hypothetical protein;...    34   4.2  
UniRef50_Q2CK49 Cluster: Putative uncharacterized protein; n=1; ...    34   4.2  
UniRef50_Q38EQ4 Cluster: Putative uncharacterized protein; n=1; ...    34   4.2  
UniRef50_Q6ZQS2 Cluster: CDNA FLJ45585 fis, clone BRTHA3013882; ...    34   4.2  
UniRef50_UPI0000F1E33E Cluster: PREDICTED: hypothetical protein;...    33   5.6  
UniRef50_UPI0000F33B7F Cluster: UPI0000F33B7F related cluster; n...    33   5.6  
UniRef50_Q82D83 Cluster: Putative uncharacterized protein; n=1; ...    33   5.6  
UniRef50_Q0RXT1 Cluster: Putative uncharacterized protein; n=1; ...    33   5.6  
UniRef50_Q5V6T4 Cluster: Putative uncharacterized protein; n=1; ...    33   5.6  
UniRef50_Q9CST8 Cluster: 10 days embryo whole body cDNA, RIKEN f...    33   7.4  
UniRef50_Q7NAN4 Cluster: Putative uncharacterized protein; n=1; ...    33   7.4  
UniRef50_Q0A5L9 Cluster: TrkA-N domain protein; n=4; Gammaproteo...    33   7.4  
UniRef50_UPI0000D9AF71 Cluster: PREDICTED: hypothetical protein;...    33   9.7  
UniRef50_UPI0000F319C7 Cluster: UPI0000F319C7 related cluster; n...    33   9.7  
UniRef50_A3CGC0 Cluster: Putative uncharacterized protein; n=1; ...    33   9.7  

>UniRef50_UPI00015B4C08 Cluster: PREDICTED: similar to CG2534-PB; n=1;
            Nasonia vitripennis|Rep: PREDICTED: similar to CG2534-PB
            - Nasonia vitripennis
          Length = 2836

 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 26/46 (56%), Positives = 31/46 (67%)
 Frame = +3

Query: 132  PGTGSARRWSAAVPPGLAEFVAPLQRAGLCLLAHQPHAVGAWTVYM 269
            P  G +      VPPGLAEF+APLQR GLC +A QP + G WT+YM
Sbjct: 953  PDDGYSCEVIRGVPPGLAEFLAPLQRDGLCRMAAQPTSSGYWTIYM 998


>UniRef50_UPI0000D56031 Cluster: PREDICTED: similar to CG2534-PA,
            isoform A; n=1; Tribolium castaneum|Rep: PREDICTED:
            similar to CG2534-PA, isoform A - Tribolium castaneum
          Length = 1742

 Score = 56.0 bits (129), Expect = 9e-07
 Identities = 25/42 (59%), Positives = 30/42 (71%)
 Frame = +3

Query: 168  VPPGLAEFVAPLQRAGLCLLAHQPHAVGAWTVYMGRASPLTA 293
            VPPGLA+F+ PLQ +GLC LA QP + G WTVYM    P +A
Sbjct: 882  VPPGLADFLHPLQASGLCRLAAQPTSSGHWTVYMSAPRPPSA 923


>UniRef50_Q95TT5 Cluster: LD24616p; n=6; Diptera|Rep: LD24616p -
            Drosophila melanogaster (Fruit fly)
          Length = 2051

 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 19/34 (55%), Positives = 26/34 (76%)
 Frame = +3

Query: 168  VPPGLAEFVAPLQRAGLCLLAHQPHAVGAWTVYM 269
            +P GL +F+ PLQ+ G+C LA QP ++G WTVYM
Sbjct: 957  IPTGLVDFLNPLQQQGMCRLAAQPTSIGLWTVYM 990



 Score = 37.1 bits (82), Expect = 0.45
 Identities = 14/25 (56%), Positives = 21/25 (84%)
 Frame = +1

Query: 295  PVPDRHILQLHKNANGMGLILVSAK 369
            P P+  +++LHKN+NGMGL +V+AK
Sbjct: 1006 PQPELQLIKLHKNSNGMGLSIVAAK 1030


>UniRef50_Q17CZ0 Cluster: Afadin; n=3; Culicidae|Rep: Afadin - Aedes
            aegypti (Yellowfever mosquito)
          Length = 1401

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 18/34 (52%), Positives = 25/34 (73%)
 Frame = +3

Query: 168  VPPGLAEFVAPLQRAGLCLLAHQPHAVGAWTVYM 269
            +P GL +F++P Q A +C LA QP ++G WTVYM
Sbjct: 979  IPAGLVDFLSPFQMANMCRLASQPTSIGLWTVYM 1012



 Score = 38.7 bits (86), Expect = 0.15
 Identities = 16/25 (64%), Positives = 21/25 (84%)
 Frame = +1

Query: 295  PVPDRHILQLHKNANGMGLILVSAK 369
            P P+  I++LHKNANGMGL +V+AK
Sbjct: 1029 PQPEIQIIKLHKNANGMGLSIVAAK 1053


>UniRef50_Q4YBB2 Cluster: Putative uncharacterized protein; n=1;
           Plasmodium berghei|Rep: Putative uncharacterized protein
           - Plasmodium berghei
          Length = 107

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 23/48 (47%), Positives = 29/48 (60%)
 Frame = +3

Query: 594 VCLV*CLCYSLRGNSAYIAMYTGMYVCLSYVYRHVCMSLVCISVCMYV 737
           VC+  C+ Y       Y+ MY  MYVC+ YV  +VCM  VC+ VCMYV
Sbjct: 3   VCMYVCM-YVCMYVCMYVCMYVCMYVCM-YVCMYVCM-YVCMYVCMYV 47



 Score = 42.3 bits (95), Expect = 0.012
 Identities = 22/54 (40%), Positives = 31/54 (57%)
 Frame = +3

Query: 573 CIFRLSQVCLV*CLCYSLRGNSAYIAMYTGMYVCLSYVYRHVCMSLVCISVCMY 734
           C++    VC+  C+   +     Y+ MY  MYVC+ YV  +VCM  VC+ VCMY
Sbjct: 4   CMYVCMYVCMYVCMYVCM-----YVCMYVCMYVCM-YVCMYVCM-YVCMYVCMY 50



 Score = 41.1 bits (92), Expect = 0.028
 Identities = 19/32 (59%), Positives = 23/32 (71%)
 Frame = +3

Query: 642 YIAMYTGMYVCLSYVYRHVCMSLVCISVCMYV 737
           Y+ MY  MYVC+ YV  +VCM  VC+ VCMYV
Sbjct: 2   YVCMYVCMYVCM-YVCMYVCM-YVCMYVCMYV 31


>UniRef50_A7SV26 Cluster: Predicted protein; n=1; Nematostella
            vectensis|Rep: Predicted protein - Nematostella vectensis
          Length = 1103

 Score = 41.1 bits (92), Expect = 0.028
 Identities = 18/36 (50%), Positives = 21/36 (58%)
 Frame = +3

Query: 168  VPPGLAEFVAPLQRAGLCLLAHQPHAVGAWTVYMGR 275
            VP GL EF+ PL   GLC L  Q  + G WTVY  +
Sbjct: 929  VPQGLREFLEPLANTGLCKLTIQTVSSGLWTVYQSK 964


>UniRef50_Q4REG5 Cluster: Chromosome 10 SCAF15123, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 10 SCAF15123, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 680

 Score = 40.3 bits (90), Expect = 0.049
 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 1/51 (1%)
 Frame = +3

Query: 132 PGTGSARRWSAAVPPGLAEFVAPLQRAGLCLLAHQPHAVGAWTV-YMGRAS 281
           P  G +      +PPG  EF+ P+ + GLC L  Q ++ G WTV + G AS
Sbjct: 358 PDAGFSCDTMRGIPPGFLEFLEPVCQKGLCHLTIQTNSEGIWTVHFTGSAS 408


>UniRef50_Q32RI6 Cluster: Putative uncharacterized protein orf115;
           n=1; Zygnema circumcarinatum|Rep: Putative
           uncharacterized protein orf115 - Zygnema circumcarinatum
           (Green alga)
          Length = 115

 Score = 39.9 bits (89), Expect = 0.064
 Identities = 19/43 (44%), Positives = 28/43 (65%), Gaps = 3/43 (6%)
 Frame = +1

Query: 616 AILYEETLLISLCIPVCMYVS--RMYIGMYVCLSYVY-RYVCM 735
           ++L+  ++   LC+ VCMYV    MY+ MYVC+ Y+Y  Y CM
Sbjct: 6   SLLFALSVRFLLCMYVCMYVCILYMYVCMYVCILYMYVSYTCM 48



 Score = 38.3 bits (85), Expect = 0.20
 Identities = 24/59 (40%), Positives = 34/59 (57%), Gaps = 2/59 (3%)
 Frame = +2

Query: 569 LLYIQIVSGLSCLMSLLFSTRKLC-LYRYVYRYVCMSLVCIS-ACMYVSRMYIGMYVCL 739
           LL+   V  L C+   ++    +C LY YV  YVC+  + +S  CMYV  MY+ MYVC+
Sbjct: 7   LLFALSVRFLLCMYVCMY----VCILYMYVCMYVCILYMYVSYTCMYVC-MYVCMYVCM 60



 Score = 37.1 bits (82), Expect = 0.45
 Identities = 17/30 (56%), Positives = 21/30 (70%), Gaps = 1/30 (3%)
 Frame = +3

Query: 651 MYTGMYVCLSYVY-RHVCMSLVCISVCMYV 737
           MY  MYVC+ Y+Y  + CM  VC+ VCMYV
Sbjct: 30  MYVCMYVCILYMYVSYTCM-YVCMYVCMYV 58



 Score = 35.9 bits (79), Expect = 1.0
 Identities = 20/49 (40%), Positives = 28/49 (57%), Gaps = 1/49 (2%)
 Frame = +3

Query: 594 VCLV*CLCYSLRGNSAYIAMYTG-MYVCLSYVYRHVCMSLVCISVCMYV 737
           VC+  C+ Y       Y+ MY   +Y+ +SY   +VCM  VC+ VCMYV
Sbjct: 21  VCMYVCILYM------YVCMYVCILYMYVSYTCMYVCM-YVCMYVCMYV 62


>UniRef50_Q4X807 Cluster: Putative uncharacterized protein; n=1;
           Plasmodium chabaudi|Rep: Putative uncharacterized
           protein - Plasmodium chabaudi
          Length = 104

 Score = 37.9 bits (84), Expect = 0.26
 Identities = 23/56 (41%), Positives = 29/56 (51%), Gaps = 1/56 (1%)
 Frame = +3

Query: 573 CIFRLSQVCLV*CLC-YSLRGNSAYIAMYTGMYVCLSYVYRHVCMSLVCISVCMYV 737
           CI +   V +  C+C Y        + M   MYVC   VY +VCM  VC+ VCMYV
Sbjct: 6   CIVQCIHVFIYVCVCMYICVYVCVCVCMCVCMYVC---VYAYVCM-YVCVCVCMYV 57



 Score = 37.1 bits (82), Expect = 0.45
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 5/58 (8%)
 Frame = +3

Query: 573 CIFRLSQVCLV*CLCYSLRGNSAYIAMYTGMYVCL-----SYVYRHVCMSLVCISVCM 731
           C++  + VC+  C+C  +     Y+ M   MYVC+      YVY +VCM  VC+ +CM
Sbjct: 40  CVY--AYVCMYVCVCVCM-----YVCMRLYMYVCMPMYVCMYVYVYVCM-CVCVYICM 89



 Score = 36.7 bits (81), Expect = 0.60
 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 1/47 (2%)
 Frame = +2

Query: 602 CLMSLLFSTRKLCLYRYVYRYVCMSLVCISACMYVS-RMYIGMYVCL 739
           C++  +     +C+  Y+  YVC+  VC+  CMYV    Y+ MYVC+
Sbjct: 6   CIVQCIHVFIYVCVCMYICVYVCV-CVCMCVCMYVCVYAYVCMYVCV 51



 Score = 35.5 bits (78), Expect = 1.4
 Identities = 22/61 (36%), Positives = 34/61 (55%), Gaps = 6/61 (9%)
 Frame = +3

Query: 573 CIFRLSQVCLV*CLCYSLRGNS-AYIAMYT----GMYVCLSYVYRHVCMSL-VCISVCMY 734
           C++    VC+  C+C  +     AY+ MY      MYVC+  +Y +VCM + VC+ V +Y
Sbjct: 20  CMYICVYVCVCVCMCVCMYVCVYAYVCMYVCVCVCMYVCMR-LYMYVCMPMYVCMYVYVY 78

Query: 735 V 737
           V
Sbjct: 79  V 79



 Score = 34.3 bits (75), Expect = 3.2
 Identities = 19/48 (39%), Positives = 25/48 (52%), Gaps = 13/48 (27%)
 Frame = +2

Query: 635 LCLYRYVYRYVCMSLVCISACMYVSR-------------MYIGMYVCL 739
           +C+Y  VY YVCM  VC+  CMYV               MY+ +YVC+
Sbjct: 35  VCMYVCVYAYVCM-YVCVCVCMYVCMRLYMYVCMPMYVCMYVYVYVCM 81


>UniRef50_Q6ZTU1 Cluster: CDNA FLJ44225 fis, clone THYMU3006168;
           n=2; Homo sapiens|Rep: CDNA FLJ44225 fis, clone
           THYMU3006168 - Homo sapiens (Human)
          Length = 262

 Score = 37.5 bits (83), Expect = 0.34
 Identities = 18/56 (32%), Positives = 34/56 (60%), Gaps = 1/56 (1%)
 Frame = +3

Query: 573 CIFRLSQVCLV*CLCYSLRGNSAYIAMYTGMYVCL-SYVYRHVCMSLVCISVCMYV 737
           CIF  + VC+  C C  +     YI +Y GM++C+ SY++R+  +  + I +C+++
Sbjct: 164 CIFIYTYVCMCVCSCIHVY-TCVYIHIYIGMHICVYSYMHRYTYV-YIHIYICIHM 217



 Score = 36.3 bits (80), Expect = 0.79
 Identities = 15/50 (30%), Positives = 33/50 (66%), Gaps = 5/50 (10%)
 Frame = +2

Query: 605 LMSLLFSTRKLCLYR--YVYRYVCM---SLVCISACMYVSRMYIGMYVCL 739
           + + ++S  ++C++   ++Y YVCM   S + +  C+Y+  +YIGM++C+
Sbjct: 149 MRAYVYSYTRICIHICIFIYTYVCMCVCSCIHVYTCVYI-HIYIGMHICV 197


>UniRef50_A6NLZ5 Cluster: Uncharacterized protein ENSP00000371562;
           n=3; Eukaryota|Rep: Uncharacterized protein
           ENSP00000371562 - Homo sapiens (Human)
          Length = 162

 Score = 37.1 bits (82), Expect = 0.45
 Identities = 15/34 (44%), Positives = 24/34 (70%), Gaps = 1/34 (2%)
 Frame = +2

Query: 635 LCLYRYVYRYVCMSL-VCISACMYVSRMYIGMYV 733
           +C+Y YVY+Y+C+ + + I  CMY+   YI MY+
Sbjct: 50  ICVYAYVYKYMCVCVRIYIHTCMYI-YTYICMYI 82


>UniRef50_Q4XP80 Cluster: Putative uncharacterized protein; n=1;
           Plasmodium chabaudi|Rep: Putative uncharacterized
           protein - Plasmodium chabaudi
          Length = 73

 Score = 36.7 bits (81), Expect = 0.60
 Identities = 17/36 (47%), Positives = 24/36 (66%)
 Frame = +1

Query: 619 ILYEETLLISLCIPVCMYVSRMYIGMYVCLSYVYRY 726
           +L++      LC+ +CMYV  MYI MYVC +Y+Y Y
Sbjct: 1   MLFQNAYTHILCMYICMYVC-MYIYMYVC-TYIYMY 34


>UniRef50_Q64239 Cluster: 1st Met is at position 21; n=1; Mus
           sp.|Rep: 1st Met is at position 21 - Mus sp
          Length = 115

 Score = 36.3 bits (80), Expect = 0.79
 Identities = 15/31 (48%), Positives = 22/31 (70%)
 Frame = +1

Query: 643 ISLCIPVCMYVSRMYIGMYVCLSYVYRYVCM 735
           I +C+  CMYVS M++ MYVC+  +  YVC+
Sbjct: 13  IHICVCSCMYVS-MHLPMYVCMYVLCTYVCI 42


>UniRef50_UPI0000E48CF0 Cluster: PREDICTED: similar to abc
            transporter, partial; n=4; Strongylocentrotus
            purpuratus|Rep: PREDICTED: similar to abc transporter,
            partial - Strongylocentrotus purpuratus
          Length = 1610

 Score = 35.9 bits (79), Expect = 1.0
 Identities = 16/49 (32%), Positives = 29/49 (59%)
 Frame = +1

Query: 556  WVSQIIVYSDCLRFVLFDVFAILYEETLLISLCIPVCMYVSRMYIGMYV 702
            WV   IV++ C+ F+ FD F  +     +I + IP+ +++  M+I +YV
Sbjct: 1188 WVPNAIVHTYCISFI-FDKFETVQSYAFVIFVEIPLFLFLPTMFIDLYV 1235


>UniRef50_Q5TIG5 Cluster: Myeloid/lymphoid or mixed-lineage leukemia
            (Trithorax homolog, Drosophila); translocated to, 4;
            n=20; Euteleostomi|Rep: Myeloid/lymphoid or mixed-lineage
            leukemia (Trithorax homolog, Drosophila); translocated
            to, 4 - Homo sapiens (Human)
          Length = 1665

 Score = 35.9 bits (79), Expect = 1.0
 Identities = 14/33 (42%), Positives = 19/33 (57%)
 Frame = +3

Query: 168  VPPGLAEFVAPLQRAGLCLLAHQPHAVGAWTVY 266
            +P GL EF+ PL + G C L     + G WT+Y
Sbjct: 948  IPNGLQEFLDPLCQRGFCRLIPHTRSPGTWTIY 980


>UniRef50_P55196 Cluster: Afadin; n=26; Amniota|Rep: Afadin - Homo
            sapiens (Human)
          Length = 1816

 Score = 35.9 bits (79), Expect = 1.0
 Identities = 14/33 (42%), Positives = 19/33 (57%)
 Frame = +3

Query: 168  VPPGLAEFVAPLQRAGLCLLAHQPHAVGAWTVY 266
            +P GL EF+ PL + G C L     + G WT+Y
Sbjct: 932  IPNGLQEFLDPLCQRGFCRLIPHTRSPGTWTIY 964


>UniRef50_Q64238 Cluster: Orf2 5' of EpoR protein; n=1; Mus sp.|Rep:
           Orf2 5' of EpoR protein - Mus sp
          Length = 85

 Score = 35.5 bits (78), Expect = 1.4
 Identities = 24/64 (37%), Positives = 37/64 (57%), Gaps = 7/64 (10%)
 Frame = +3

Query: 567 NYCIFRLSQVCLV*C--LCYSLRGNSAYIAMYTGMYVCLSYVYRHVCMSL-VCI----SV 725
           N C++  S +CL  C  +C  +    AY+  YT +Y+C+  VY ++C+ + VCI     V
Sbjct: 6   NVCMY--SSICLPICPWVCQCMY---AYVNQYTYLYLCIC-VYPYMCLFMYVCIHASTHV 59

Query: 726 CMYV 737
           CMYV
Sbjct: 60  CMYV 63


>UniRef50_A7TBF1 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 93

 Score = 35.5 bits (78), Expect = 1.4
 Identities = 18/41 (43%), Positives = 22/41 (53%), Gaps = 8/41 (19%)
 Frame = +2

Query: 638 CLY---RYVYRYVCMSL-----VCISACMYVSRMYIGMYVC 736
           CLY    Y+  YVCM L     VC+  C+YV   Y+  YVC
Sbjct: 12  CLYVCSSYLSNYVCMELYICGSVCLFPCLYVCSSYLSNYVC 52



 Score = 35.1 bits (77), Expect = 1.8
 Identities = 13/31 (41%), Positives = 22/31 (70%), Gaps = 1/31 (3%)
 Frame = +3

Query: 645 IAMYTGMYVCLSYVYRHVCMSL-VCISVCMY 734
           + ++  +YVC SY+  +VCM L +C SVC++
Sbjct: 7   VCLFPCLYVCSSYLSNYVCMELYICGSVCLF 37


>UniRef50_UPI0000DBFC45 Cluster: UPI0000DBFC45 related cluster; n=1;
           Rattus norvegicus|Rep: UPI0000DBFC45 UniRef100 entry -
           Rattus norvegicus
          Length = 272

 Score = 35.1 bits (77), Expect = 1.8
 Identities = 21/61 (34%), Positives = 35/61 (57%), Gaps = 5/61 (8%)
 Frame = +3

Query: 570 YCIFRLSQ--VCLV*CLCYSLRGNSAYIAMYTGMYVCL-SYVYRHVCMSLV--CISVCMY 734
           +C++  +   VC   CLC  +     Y+ M   +Y+CL  +VY ++CM +V  C+ VC+Y
Sbjct: 24  FCVYICTSIVVCTRVCLCMYM-----YVVMC--LYICLLMHVYMYMCMYIVYLCVYVCIY 76

Query: 735 V 737
           V
Sbjct: 77  V 77



 Score = 34.3 bits (75), Expect = 3.2
 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 5/49 (10%)
 Frame = +2

Query: 602 CLMSLLFSTRKLCLYRYVYRYVCMSLV--CISACMYV---SRMYIGMYV 733
           C+   +     +CL  +VY Y+CM +V  C+  C+YV     +Y+ MYV
Sbjct: 41  CMYMYVVMCLYICLLMHVYMYMCMYIVYLCVYVCIYVYIFMCVYLYMYV 89


>UniRef50_Q4T539 Cluster: Chromosome undetermined SCAF9438, whole
           genome shotgun sequence; n=1; Tetraodon
           nigroviridis|Rep: Chromosome undetermined SCAF9438,
           whole genome shotgun sequence - Tetraodon nigroviridis
           (Green puffer)
          Length = 525

 Score = 35.1 bits (77), Expect = 1.8
 Identities = 19/68 (27%), Positives = 31/68 (45%)
 Frame = -2

Query: 301 GRAAVSGDARPMYTVHAPTACGWCASRHSPARCRGATNSASPGGTAADHLRAEPVPGDQQ 122
           G +  SG + P+   H P      +S  S   C  A    + GG AA+ ++ +  PG + 
Sbjct: 157 GLSTQSGSSGPL-NAHTPARPSSTSSTGSRGSCSSAGRGTASGGAAAEQVKVKQEPGTED 215

Query: 121 SGPQPTAL 98
           S   P++L
Sbjct: 216 SYSCPSSL 223


>UniRef50_Q4SA46 Cluster: Chromosome 12 SCAF14692, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 12 SCAF14692, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 749

 Score = 34.7 bits (76), Expect = 2.4
 Identities = 28/74 (37%), Positives = 30/74 (40%), Gaps = 2/74 (2%)
 Frame = -2

Query: 316 GYVGRGRAAVSGDARPMYTVHAPTACGWCASRHSPARCRGATNSASPGGTA--ADHLRAE 143
           G  G G  A  G   P  TV      GW    HSP R RG   +A PGG A   D L A 
Sbjct: 540 GSGGAGEEAGRGAEGPPRTVP-----GWAG--HSPQRPRGGPGAAQPGGAAVCGDALSAG 592

Query: 142 PVPGDQQSGPQPTA 101
               D+  G  P A
Sbjct: 593 GERADEDHGRDPRA 606


>UniRef50_Q62097 Cluster: Mus musculus ORFs (putative primordial
           protein), complete cds; n=6; Eukaryota|Rep: Mus musculus
           ORFs (putative primordial protein), complete cds - Mus
           musculus (Mouse)
          Length = 250

 Score = 34.7 bits (76), Expect = 2.4
 Identities = 21/58 (36%), Positives = 36/58 (62%), Gaps = 1/58 (1%)
 Frame = +2

Query: 569 LLYIQIVSGLSCLMSLLFSTRKLCLYRYVY-RYVCMSLVCISACMYVSRMYIGMYVCL 739
           L Y+ +   LS +   ++ +  LC+Y  +Y  YVC+S +C+S  +Y+S +Y+  YVCL
Sbjct: 127 LSYVCLSIYLSIICLSVYLSIYLCIYLSIYLSYVCLSSICLS--IYLS-IYLS-YVCL 180


>UniRef50_Q6ZUP2 Cluster: CDNA FLJ43495 fis, clone PEBLM2000338;
           n=2; Homo sapiens|Rep: CDNA FLJ43495 fis, clone
           PEBLM2000338 - Homo sapiens (Human)
          Length = 148

 Score = 34.7 bits (76), Expect = 2.4
 Identities = 16/47 (34%), Positives = 28/47 (59%)
 Frame = +3

Query: 597 CLV*CLCYSLRGNSAYIAMYTGMYVCLSYVYRHVCMSLVCISVCMYV 737
           C+  C+   +     YI +Y  +YVC+ Y++  VC+ ++ I VC+YV
Sbjct: 12  CIYVCIYIHVFVYVCYIYLY--VYVCVIYIHVCVCVCVLYIHVCVYV 56


>UniRef50_Q47ML7 Cluster: Putative uncharacterized protein; n=1;
           Thermobifida fusca YX|Rep: Putative uncharacterized
           protein - Thermobifida fusca (strain YX)
          Length = 361

 Score = 34.3 bits (75), Expect = 3.2
 Identities = 22/58 (37%), Positives = 30/58 (51%), Gaps = 4/58 (6%)
 Frame = -2

Query: 271 PMYTVHAPTACGWCASRHSPARCR--GATN-SASPGGTAADHLRAEP-VPGDQQSGPQ 110
           P+ T+ + TACGWC  R   + CR  GA N + +   TAA H    P  P    +GP+
Sbjct: 243 PVRTLRS-TACGWCRERVVSSYCRFCGAVNRTPARRPTAAPHAHMRPQTPPPAPAGPR 299


>UniRef50_Q75J12 Cluster: Putative uncharacterized protein
           OSJNBb0081K01.15; n=1; Oryza sativa (japonica
           cultivar-group)|Rep: Putative uncharacterized protein
           OSJNBb0081K01.15 - Oryza sativa subsp. japonica (Rice)
          Length = 153

 Score = 34.3 bits (75), Expect = 3.2
 Identities = 18/36 (50%), Positives = 21/36 (58%), Gaps = 2/36 (5%)
 Frame = -2

Query: 229 ASRHSPARCRGATNSASPGG--TAADHLRAEPVPGD 128
           + R SP+  RG T    PGG  TAA  LRA P+ GD
Sbjct: 91  SERSSPSGLRGGTGHPKPGGGGTAALFLRARPIHGD 126


>UniRef50_Q19TX3 Cluster: NADH dehydrogenase subunit 6; n=1; Idotea
           baltica|Rep: NADH dehydrogenase subunit 6 - Idotea
           baltica
          Length = 165

 Score = 34.3 bits (75), Expect = 3.2
 Identities = 14/36 (38%), Positives = 24/36 (66%)
 Frame = +2

Query: 593 GLSCLMSLLFSTRKLCLYRYVYRYVCMSLVCISACM 700
           G SC++S LFST  + +Y  V  Y+ ++L+C++  M
Sbjct: 119 GSSCVISELFSTDNMLMYLCVVIYLLLALICVANLM 154


>UniRef50_Q6ZVA9 Cluster: CDNA FLJ42813 fis, clone BRCAN2012355;
           n=1; Homo sapiens|Rep: CDNA FLJ42813 fis, clone
           BRCAN2012355 - Homo sapiens (Human)
          Length = 180

 Score = 34.3 bits (75), Expect = 3.2
 Identities = 13/36 (36%), Positives = 24/36 (66%), Gaps = 1/36 (2%)
 Frame = +2

Query: 635 LCLYRYVYRYVCMSL-VCISACMYVSRMYIGMYVCL 739
           +C+Y Y+Y Y+   + +C+   MYVS +Y+ +Y C+
Sbjct: 93  MCVYTYIYVYIYTHIHICVHINMYVS-IYVYIYTCI 127


>UniRef50_Q55QY7 Cluster: Putative uncharacterized protein; n=2;
           Filobasidiella neoformans|Rep: Putative uncharacterized
           protein - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 692

 Score = 34.3 bits (75), Expect = 3.2
 Identities = 26/64 (40%), Positives = 32/64 (50%), Gaps = 3/64 (4%)
 Frame = +3

Query: 129 SPGTGSARRWSAAVPPG--LAEF-VAPLQRAGLCLLAHQPHAVGAWTVYMGRASPLTAAR 299
           SPG G +R  SA V PG  LA + +APL       LA QP  +  WT     + PL +A 
Sbjct: 57  SPGKGQSR--SAPVSPGGRLALYGIAPLSSISPIHLAQQPENMRQWTSSSTHSPPLDSAS 114

Query: 300 PRPT 311
            R T
Sbjct: 115 FRET 118


>UniRef50_UPI0000DD78AE Cluster: PREDICTED: hypothetical protein;
           n=1; Homo sapiens|Rep: PREDICTED: hypothetical protein -
           Homo sapiens
          Length = 305

 Score = 33.9 bits (74), Expect = 4.2
 Identities = 26/73 (35%), Positives = 33/73 (45%), Gaps = 4/73 (5%)
 Frame = -2

Query: 307 GRGRAAVSGDARPMYTVHAPTACGWCASRHSPARCRGATNSASPGGTA----ADHLRAEP 140
           GRGR+A +G  R  + V   ++    A+  S ARCR A    S  G A    A   RA P
Sbjct: 228 GRGRSARAGSPRLPFPVPGKSSLRGLAASRSRARCRSALAWGSAAGAAPQLGAPQCRA-P 286

Query: 139 VPGDQQSGPQPTA 101
           VP    +   P A
Sbjct: 287 VPARLPNAAAPPA 299


>UniRef50_Q2CK49 Cluster: Putative uncharacterized protein; n=1;
           Oceanicola granulosus HTCC2516|Rep: Putative
           uncharacterized protein - Oceanicola granulosus HTCC2516
          Length = 278

 Score = 33.9 bits (74), Expect = 4.2
 Identities = 22/62 (35%), Positives = 27/62 (43%), Gaps = 2/62 (3%)
 Frame = +3

Query: 117 PDC*SPGTGSARRWSAAVPPGLAEFVAPLQRAGLCLLAHQPHAVGAWTVYM--GRASPLT 290
           PD    GTG A +W      G  E +A      L  +A +P A G +TVY   G   P  
Sbjct: 118 PDAVPEGTGRAPQWRELRSNGALEALAIAPDGALYTVAEEPDADGLFTVYRRGGEGGPWR 177

Query: 291 AA 296
           AA
Sbjct: 178 AA 179


>UniRef50_Q38EQ4 Cluster: Putative uncharacterized protein; n=1;
           Trypanosoma brucei|Rep: Putative uncharacterized protein
           - Trypanosoma brucei
          Length = 123

 Score = 33.9 bits (74), Expect = 4.2
 Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%)
 Frame = +3

Query: 642 YIAMYTGMYVCLS-YVYRHVCMSLVCISVCMYVS 740
           Y+ MY  MYVC+  Y+Y  VC+  V + +C Y +
Sbjct: 25  YVCMYACMYVCMYIYIYICVCVCGVLLRMCTYTT 58



 Score = 33.1 bits (72), Expect = 7.4
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 638 CLYRYVYRYVCMSLVCISACMYVSRMYIGMYVCL 739
           C+  +   YV    VC+ ACMYV  MYI +Y+C+
Sbjct: 12  CVAVFRQMYVTRVYVCMYACMYVC-MYIYIYICV 44



 Score = 32.7 bits (71), Expect = 9.7
 Identities = 12/26 (46%), Positives = 19/26 (73%), Gaps = 3/26 (11%)
 Frame = +1

Query: 667 MYVSRMYIGMYVCL---SYVYRYVCM 735
           MYV+R+Y+ MY C+    Y+Y Y+C+
Sbjct: 19  MYVTRVYVCMYACMYVCMYIYIYICV 44


>UniRef50_Q6ZQS2 Cluster: CDNA FLJ45585 fis, clone BRTHA3013882;
           n=10; root|Rep: CDNA FLJ45585 fis, clone BRTHA3013882 -
           Homo sapiens (Human)
          Length = 201

 Score = 33.9 bits (74), Expect = 4.2
 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 1/56 (1%)
 Frame = +3

Query: 573 CIFRLSQVCLV*CLCYSLRGNSAYIAMYTGMYVCLSYVYRHVCMSL-VCISVCMYV 737
           C+     VC+  CLC  +   S  + +   + +C+  V   +C+ L VC+SVC+ V
Sbjct: 28  CVCLCVCVCVCVCLCLCVLSVSVCLCVCVSVCLCVCLVSVCLCVCLCVCVSVCLCV 83


>UniRef50_UPI0000F1E33E Cluster: PREDICTED: hypothetical protein;
           n=1; Danio rerio|Rep: PREDICTED: hypothetical protein -
           Danio rerio
          Length = 473

 Score = 33.5 bits (73), Expect = 5.6
 Identities = 19/70 (27%), Positives = 30/70 (42%)
 Frame = -2

Query: 289 VSGDARPMYTVHAPTACGWCASRHSPARCRGATNSASPGGTAADHLRAEPVPGDQQSGPQ 110
           V    R  +   +  A G+  +  +P R  GAT +  P GT      A P P  + +GP 
Sbjct: 234 VGSSPRAQFNAGSSPAPGFTGATQAP-RPAGATQAPRPAGTTQTSCPAGPNPAPRPAGPS 292

Query: 109 PTALLDSYLQ 80
           P   + + +Q
Sbjct: 293 PAPGITNAIQ 302


>UniRef50_UPI0000F33B7F Cluster: UPI0000F33B7F related cluster; n=1;
           Bos taurus|Rep: UPI0000F33B7F UniRef100 entry - Bos
           Taurus
          Length = 194

 Score = 33.5 bits (73), Expect = 5.6
 Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 6/52 (11%)
 Frame = +3

Query: 594 VCLV*CLCYSLRGNSAYIAMYTG------MYVCLSYVYRHVCMSLVCISVCM 731
           VC+  C+C        Y+ +Y        ++VCL  V  H+C S++C+ VC+
Sbjct: 10  VCVCVCVCDCANYCVCYLCVYIQECESVCVFVCLYMVCIHMCASVLCVRVCV 61


>UniRef50_Q82D83 Cluster: Putative uncharacterized protein; n=1;
           Streptomyces avermitilis|Rep: Putative uncharacterized
           protein - Streptomyces avermitilis
          Length = 1422

 Score = 33.5 bits (73), Expect = 5.6
 Identities = 22/60 (36%), Positives = 25/60 (41%), Gaps = 1/60 (1%)
 Frame = -2

Query: 307 GRGRAAVSGDARPM-YTVHAPTACGWCASRHSPARCRGATNSASPGGTAADHLRAEPVPG 131
           G   AA SGD RP   T HA  A  W A+  +P+   G    A   G       A  VPG
Sbjct: 274 GGASAAASGDGRPSGETHHAFGASAWGAAGGAPSAPAGGAPGAQEHGPVEPRFPAPVVPG 333


>UniRef50_Q0RXT1 Cluster: Putative uncharacterized protein; n=1;
           Rhodococcus sp. RHA1|Rep: Putative uncharacterized
           protein - Rhodococcus sp. (strain RHA1)
          Length = 180

 Score = 33.5 bits (73), Expect = 5.6
 Identities = 23/80 (28%), Positives = 34/80 (42%)
 Frame = -2

Query: 298 RAAVSGDARPMYTVHAPTACGWCASRHSPARCRGATNSASPGGTAADHLRAEPVPGDQQS 119
           R  V  D RP++      A  + A    P R    T S    GT++ ++ A P  G   +
Sbjct: 62  RLRVERDGRPIFATDGTRAWDFTADSERP-RTGPPTASFIWAGTSSYYVDAAPPSGRAMT 120

Query: 118 GPQPTALLDSYLQNPTCIES 59
            P P A     L+ PT ++S
Sbjct: 121 SPSPPAGRRDGLRRPTLLDS 140


>UniRef50_Q5V6T4 Cluster: Putative uncharacterized protein; n=1;
           Haloarcula marismortui|Rep: Putative uncharacterized
           protein - Haloarcula marismortui (Halobacterium
           marismortui)
          Length = 477

 Score = 33.5 bits (73), Expect = 5.6
 Identities = 13/32 (40%), Positives = 21/32 (65%)
 Frame = +1

Query: 283 RLPPPVPDRHILQLHKNANGMGLILVSAKVLF 378
           R+  PV  + +L +H++A G G +L SA +LF
Sbjct: 257 RIGDPVATKSLLDIHRSAGGFGKVLFSAAILF 288


>UniRef50_Q9CST8 Cluster: 10 days embryo whole body cDNA, RIKEN
           full-length enriched library, clone:2610306H15
           product:hypothetical Aldo/keto reductase family
           containing protein, full insert sequence; n=1; Mus
           musculus|Rep: 10 days embryo whole body cDNA, RIKEN
           full-length enriched library, clone:2610306H15
           product:hypothetical Aldo/keto reductase family
           containing protein, full insert sequence - Mus musculus
           (Mouse)
          Length = 216

 Score = 33.1 bits (72), Expect = 7.4
 Identities = 24/66 (36%), Positives = 27/66 (40%), Gaps = 1/66 (1%)
 Frame = +3

Query: 132 PGTGSARRWSAAVP-PGLAEFVAPLQRAGLCLLAHQPHAVGAWTVYMGRASPLTAARPRP 308
           PG    RR   A+P PG  E    L RA   L  H+  A        GRA+  T A P P
Sbjct: 40  PGDADWRRAGLALPDPGRGESALRLPRASGALRGHRRPARALLETAAGRAAQETTALPGP 99

Query: 309 TYPATT 326
              A T
Sbjct: 100 RAAAAT 105


>UniRef50_Q7NAN4 Cluster: Putative uncharacterized protein; n=1;
           Mycoplasma gallisepticum|Rep: Putative uncharacterized
           protein - Mycoplasma gallisepticum
          Length = 501

 Score = 33.1 bits (72), Expect = 7.4
 Identities = 16/40 (40%), Positives = 22/40 (55%)
 Frame = -2

Query: 193 TNSASPGGTAADHLRAEPVPGDQQSGPQPTALLDSYLQNP 74
           +N+   G  A + + A+P PG  Q  PQPTA +   L NP
Sbjct: 66  SNAKKEGMPAVNRMPAKPGPGLNQPQPQPTAKVAPNLNNP 105


>UniRef50_Q0A5L9 Cluster: TrkA-N domain protein; n=4;
           Gammaproteobacteria|Rep: TrkA-N domain protein -
           Alkalilimnicola ehrlichei (strain MLHE-1)
          Length = 583

 Score = 33.1 bits (72), Expect = 7.4
 Identities = 14/25 (56%), Positives = 18/25 (72%)
 Frame = -2

Query: 139 VPGDQQSGPQPTALLDSYLQNPTCI 65
           VPG +    QPTALLD+ LQ+P C+
Sbjct: 171 VPGLRTDAGQPTALLDAGLQHPCCV 195


>UniRef50_UPI0000D9AF71 Cluster: PREDICTED: hypothetical protein;
           n=1; Macaca mulatta|Rep: PREDICTED: hypothetical protein
           - Macaca mulatta
          Length = 445

 Score = 32.7 bits (71), Expect = 9.7
 Identities = 17/56 (30%), Positives = 31/56 (55%)
 Frame = +3

Query: 573 CIFRLSQVCLV*CLCYSLRGNSAYIAMYTGMYVCLSYVYRHVCMSLVCISVCMYVS 740
           CI     +C+  C+C  +      +  YT + +C+S +   VC+  +CIS+C+Y+S
Sbjct: 193 CICICISMCIYICICICIS-----MCTYTCICICIS-ICTCVCIC-ICISMCIYIS 241


>UniRef50_UPI0000F319C7 Cluster: UPI0000F319C7 related cluster; n=1;
           Bos taurus|Rep: UPI0000F319C7 UniRef100 entry - Bos
           Taurus
          Length = 263

 Score = 32.7 bits (71), Expect = 9.7
 Identities = 18/57 (31%), Positives = 27/57 (47%), Gaps = 2/57 (3%)
 Frame = +3

Query: 573 CIFRLSQVCLV*CLCYSLRGNSAYIAMYTGMYVCLS-YVYRHVCMSL-VCISVCMYV 737
           C    + + +  C+C S       + MYT +  C+   VY HVC S+  C  V MY+
Sbjct: 161 CTHACTHIHMCSCVCVSCVHARVCLYMYTCVQACMCVLVYVHVCSSMHTCACVYMYM 217


>UniRef50_A3CGC0 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (japonica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. japonica
           (Rice)
          Length = 163

 Score = 32.7 bits (71), Expect = 9.7
 Identities = 18/52 (34%), Positives = 24/52 (46%)
 Frame = -2

Query: 211 ARCRGATNSASPGGTAADHLRAEPVPGDQQSGPQPTALLDSYLQNPTCIESL 56
           AR RGA  +   GG  A   R  P P  ++S P P+A      + PT +  L
Sbjct: 82  ARGRGAAGARRRGGLLAALDRRRPAPPPRRSRPPPSAEASDARRQPTVVRGL 133


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 712,024,932
Number of Sequences: 1657284
Number of extensions: 14585159
Number of successful extensions: 50098
Number of sequences better than 10.0: 43
Number of HSP's better than 10.0 without gapping: 46234
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 49740
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 60500186565
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).