SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0034
         (628 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q8IGP4 Cluster: RE54276p; n=4; Endopterygota|Rep: RE542...    72   1e-11
UniRef50_Q6IDH2 Cluster: RH58004p; n=5; Diptera|Rep: RH58004p - ...    64   2e-09
UniRef50_UPI00005A0CF4 Cluster: PREDICTED: similar to NAD kinase...    44   0.003
UniRef50_Q4S107 Cluster: Chromosome 15 SCAF14771, whole genome s...    43   0.007
UniRef50_O95544 Cluster: NAD kinase (EC 2.7.1.23) (Poly(P)/ATP N...    43   0.007
UniRef50_Q4SC84 Cluster: Chromosome undetermined SCAF14659, whol...    40   0.049
UniRef50_A0VCD6 Cluster: Putative uncharacterized protein; n=1; ...    34   3.2  
UniRef50_Q5QPS4 Cluster: NAD kinase; n=4; Eutheria|Rep: NAD kina...    33   5.6  
UniRef50_A7TQ60 Cluster: Putative uncharacterized protein; n=1; ...    33   5.6  
UniRef50_Q4TEN6 Cluster: Chromosome undetermined SCAF5231, whole...    33   7.4  
UniRef50_A3UWP9 Cluster: Putative uncharacterized protein; n=3; ...    33   7.4  
UniRef50_A7SR02 Cluster: Predicted protein; n=1; Nematostella ve...    33   7.4  
UniRef50_A6S0E0 Cluster: Putative uncharacterized protein; n=1; ...    33   7.4  
UniRef50_UPI0000660D6A Cluster: Homolog of Homo sapiens "Ubiquit...    32   9.8  

>UniRef50_Q8IGP4 Cluster: RE54276p; n=4; Endopterygota|Rep: RE54276p
           - Drosophila melanogaster (Fruit fly)
          Length = 490

 Score = 71.7 bits (168), Expect = 1e-11
 Identities = 39/77 (50%), Positives = 46/77 (59%)
 Frame = +1

Query: 277 RTRSLNAPSPIQQVWTMRQDYEKFRHGHANPGSGVAEADLVKPPLTVLVIKKVHDAQILA 456
           RTRSLNAPSP+QQ     +  +                   KPPLTVLVIKKV DA +LA
Sbjct: 96  RTRSLNAPSPVQQFGPCGRIMKNSAMVMQIQDPASQRLTWYKPPLTVLVIKKVSDASVLA 155

Query: 457 PFVQLVHWLVHDKSMVV 507
           PFV LV WL+ +K+MVV
Sbjct: 156 PFVYLVDWLLQEKNMVV 172



 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 28/32 (87%), Positives = 29/32 (90%)
 Frame = +2

Query: 314 KFGPCGRIMKNSAMVMQIQDPASQRLTWSSLP 409
           +FGPCGRIMKNSAMVMQIQDPASQRLTW   P
Sbjct: 108 QFGPCGRIMKNSAMVMQIQDPASQRLTWYKPP 139


>UniRef50_Q6IDH2 Cluster: RH58004p; n=5; Diptera|Rep: RH58004p -
           Drosophila melanogaster (Fruit fly)
          Length = 548

 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 38/77 (49%), Positives = 43/77 (55%)
 Frame = +1

Query: 277 RTRSLNAPSPIQQVWTMRQDYEKFRHGHANPGSGVAEADLVKPPLTVLVIKKVHDAQILA 456
           RTRSLNAPSP Q      +  +                   KPPLTVLVIKK  D+Q+L 
Sbjct: 109 RTRSLNAPSPFQHFGPCGRIMKNSAMVMQIQDPASQRLTWYKPPLTVLVIKK-KDSQVLP 167

Query: 457 PFVQLVHWLVHDKSMVV 507
           PFVQLV WLV +K MVV
Sbjct: 168 PFVQLVEWLVQEKHMVV 184



 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 28/34 (82%), Positives = 29/34 (85%)
 Frame = +2

Query: 308 YNKFGPCGRIMKNSAMVMQIQDPASQRLTWSSLP 409
           +  FGPCGRIMKNSAMVMQIQDPASQRLTW   P
Sbjct: 119 FQHFGPCGRIMKNSAMVMQIQDPASQRLTWYKPP 152


>UniRef50_UPI00005A0CF4 Cluster: PREDICTED: similar to NAD kinase
           isoform 5; n=1; Canis lupus familiaris|Rep: PREDICTED:
           similar to NAD kinase isoform 5 - Canis familiaris
          Length = 504

 Score = 44.0 bits (99), Expect = 0.003
 Identities = 33/103 (32%), Positives = 53/103 (51%), Gaps = 3/103 (2%)
 Frame = +1

Query: 208 RQYSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWT---MRQDYEKFRHGHANPGSG 378
           R  S     +  + S++E+   RRTRSL+ P P+        + Q+ +   H   +P S 
Sbjct: 41  RAKSRSLSASPALASAKEF---RRTRSLHGPCPVTTFGPKACVLQNPQTIMHIQ-DPAS- 95

Query: 379 VAEADLVKPPLTVLVIKKVHDAQILAPFVQLVHWLVHDKSMVV 507
                  K P +VLVIKK+ DA +L PF +L  +L+ + +M+V
Sbjct: 96  -QRLTWNKSPKSVLVIKKMRDASLLQPFKELCTYLMEENNMIV 137



 Score = 42.7 bits (96), Expect = 0.007
 Identities = 17/31 (54%), Positives = 22/31 (70%)
 Frame = +2

Query: 317 FGPCGRIMKNSAMVMQIQDPASQRLTWSSLP 409
           FGP   +++N   +M IQDPASQRLTW+  P
Sbjct: 74  FGPKACVLQNPQTIMHIQDPASQRLTWNKSP 104


>UniRef50_Q4S107 Cluster: Chromosome 15 SCAF14771, whole genome
           shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 15
           SCAF14771, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 166

 Score = 42.7 bits (96), Expect = 0.007
 Identities = 19/31 (61%), Positives = 21/31 (67%)
 Frame = +2

Query: 317 FGPCGRIMKNSAMVMQIQDPASQRLTWSSLP 409
           FGP   I+ N   VM IQDPASQRLTW+  P
Sbjct: 109 FGPKACILPNPTSVMHIQDPASQRLTWNKPP 139



 Score = 35.5 bits (78), Expect = 1.1
 Identities = 14/29 (48%), Positives = 21/29 (72%)
 Frame = +1

Query: 400 KPPLTVLVIKKVHDAQILAPFVQLVHWLV 486
           KPP+ VLVI+K+ D  ++ PF +L  +LV
Sbjct: 137 KPPVNVLVIRKIRDESLVEPFKELCRFLV 165


>UniRef50_O95544 Cluster: NAD kinase (EC 2.7.1.23) (Poly(P)/ATP NAD
           kinase); n=59; Eumetazoa|Rep: NAD kinase (EC 2.7.1.23)
           (Poly(P)/ATP NAD kinase) - Homo sapiens (Human)
          Length = 446

 Score = 42.7 bits (96), Expect = 0.007
 Identities = 17/31 (54%), Positives = 22/31 (70%)
 Frame = +2

Query: 317 FGPCGRIMKNSAMVMQIQDPASQRLTWSSLP 409
           FGP   +++N   +M IQDPASQRLTW+  P
Sbjct: 74  FGPKACVLQNPQTIMHIQDPASQRLTWNKSP 104



 Score = 40.3 bits (90), Expect = 0.037
 Identities = 29/84 (34%), Positives = 43/84 (51%), Gaps = 3/84 (3%)
 Frame = +1

Query: 274 RRTRSLNAPSPIQQVWT---MRQDYEKFRHGHANPGSGVAEADLVKPPLTVLVIKKVHDA 444
           RRTRSL+ P P+        + Q+ +   H   +P S        K P +VLVIKK+ DA
Sbjct: 60  RRTRSLHGPCPVTTFGPKACVLQNPQTIMHIQ-DPAS--QRLTWNKSPKSVLVIKKMRDA 116

Query: 445 QILAPFVQLVHWLVHDKSMVVVRR 516
            +L PF +L   L+ +  +V V +
Sbjct: 117 SLLQPFKELCTHLMEENMIVYVEK 140


>UniRef50_Q4SC84 Cluster: Chromosome undetermined SCAF14659, whole
           genome shotgun sequence; n=1; Tetraodon
           nigroviridis|Rep: Chromosome undetermined SCAF14659,
           whole genome shotgun sequence - Tetraodon nigroviridis
           (Green puffer)
          Length = 600

 Score = 39.9 bits (89), Expect = 0.049
 Identities = 18/35 (51%), Positives = 25/35 (71%)
 Frame = +1

Query: 403 PPLTVLVIKKVHDAQILAPFVQLVHWLVHDKSMVV 507
           PP +VLVIKK+ DA +L PF +L  +L   K+M+V
Sbjct: 234 PPKSVLVIKKIQDASLLEPFKELCIFLAKVKNMIV 268


>UniRef50_A0VCD6 Cluster: Putative uncharacterized protein; n=1;
           Delftia acidovorans SPH-1|Rep: Putative uncharacterized
           protein - Delftia acidovorans SPH-1
          Length = 473

 Score = 33.9 bits (74), Expect = 3.2
 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 1/48 (2%)
 Frame = +2

Query: 305 QY-NKFGPCGRIMKNSAMVMQIQDPASQRLTWSSLPSPCWSSRKFTTP 445
           QY N  GPCGR ++    + +  DP   ++  +S P+P  S+R  ++P
Sbjct: 427 QYGNGLGPCGRRVRRCPQISECSDPCGAKIRTAS-PAPARSARPCSSP 473


>UniRef50_Q5QPS4 Cluster: NAD kinase; n=4; Eutheria|Rep: NAD kinase
           - Homo sapiens (Human)
          Length = 591

 Score = 33.1 bits (72), Expect = 5.6
 Identities = 19/51 (37%), Positives = 25/51 (49%)
 Frame = +1

Query: 400 KPPLTVLVIKKVHDAQILAPFVQLVHWLVHDKSMVVVRRGGSFWMTHSFAG 552
           K P +VLVIKK+ DA +L PF +L   L+  +       G   W  H   G
Sbjct: 206 KSPKSVLVIKKMRDASLLQPFKELCTHLMEARG----AGGKGAWGAHGVGG 252


>UniRef50_A7TQ60 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 408

 Score = 33.1 bits (72), Expect = 5.6
 Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 1/54 (1%)
 Frame = +1

Query: 409 LTVLVIKKVHDAQILAPFVQLVHWLVHDKSMV-VVRRGGSFWMTHSFAGVLGTL 567
           L  L  +K H+ + L+  V+ +HW VHD + V ++  G  +   H   G++  L
Sbjct: 114 LRFLRARKWHEGKALSMLVRSLHWRVHDANTVEIINHGECYAYKHKKEGLIKNL 167


>UniRef50_Q4TEN6 Cluster: Chromosome undetermined SCAF5231, whole
           genome shotgun sequence; n=1; Tetraodon
           nigroviridis|Rep: Chromosome undetermined SCAF5231,
           whole genome shotgun sequence - Tetraodon nigroviridis
           (Green puffer)
          Length = 361

 Score = 32.7 bits (71), Expect = 7.4
 Identities = 24/74 (32%), Positives = 35/74 (47%), Gaps = 1/74 (1%)
 Frame = +3

Query: 288 PERAVPNTTSLDHAAGL*KIPPWSCKSRIRRRRG*PGQASPHRAG-HQESSRRPDTGTLR 464
           PE+ V + + L+   G+  +   S   ++ + R  PG A PHRAG H      PD G LR
Sbjct: 18  PEQLVADKSLLEILDGMVMMYSLSVHQQLGKVRAWPG-AWPHRAGPHPRLRPPPDGGGLR 76

Query: 465 STSTLARS*QKHGG 506
               + R  + H G
Sbjct: 77  GRPRVRRGPEGHRG 90


>UniRef50_A3UWP9 Cluster: Putative uncharacterized protein; n=3;
            Vibrionales|Rep: Putative uncharacterized protein -
            Vibrio splendidus 12B01
          Length = 7629

 Score = 32.7 bits (71), Expect = 7.4
 Identities = 23/60 (38%), Positives = 34/60 (56%), Gaps = 1/60 (1%)
 Frame = +2

Query: 206  EGSIPMSQAKRNLSRAQRSTWTEGELDP*TRRPQYNKFGPCGRIMKNSAMVMQI-QDPAS 382
            +GS P   A   +S     T+TEG  D    R   N+F P G ++K+S +V+Q+ +DPAS
Sbjct: 4054 DGSTPSGSA---VSSTHTITYTEGSDDFSHFRIATNEFNP-GDLLKSSGLVVQLKEDPAS 4109


>UniRef50_A7SR02 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 250

 Score = 32.7 bits (71), Expect = 7.4
 Identities = 13/29 (44%), Positives = 17/29 (58%)
 Frame = -3

Query: 596 SHPDVLSPDGKVPNTPAKECVIQKLPPRR 510
           S P  L PDG V     KEC++  LPP++
Sbjct: 182 SGPRTLCPDGYVEGIEPKECILAPLPPKK 210


>UniRef50_A6S0E0 Cluster: Putative uncharacterized protein; n=1;
           Botryotinia fuckeliana B05.10|Rep: Putative
           uncharacterized protein - Botryotinia fuckeliana B05.10
          Length = 523

 Score = 32.7 bits (71), Expect = 7.4
 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 1/38 (2%)
 Frame = -2

Query: 216 ILPSQHFFKQSHHS-YTNSHRATKTSFAKPIILTYQTI 106
           + P +  F+Q+ H  Y   H +  T F KPIILT+ TI
Sbjct: 145 LYPYEKTFEQARHEPYVVLHTSGSTGFPKPIILTHGTI 182


>UniRef50_UPI0000660D6A Cluster: Homolog of Homo sapiens "Ubiquitin
           specific protease 54; n=1; Takifugu rubripes|Rep:
           Homolog of Homo sapiens "Ubiquitin specific protease 54
           - Takifugu rubripes
          Length = 713

 Score = 32.3 bits (70), Expect = 9.8
 Identities = 24/74 (32%), Positives = 32/74 (43%)
 Frame = +3

Query: 288 PERAVPNTTSLDHAAGL*KIPPWSCKSRIRRRRG*PGQASPHRAGHQESSRRPDTGTLRS 467
           P  A P+T+    A+ +   P WS  +  RR  G   Q     A    SSRRP T +  S
Sbjct: 243 PPAAEPSTSPRAAASPVTPRPRWSATTSARRHAGPRSQEYKETAVFLLSSRRPLTSSSSS 302

Query: 468 TSTLARS*QKHGGG 509
           +  L+ S     GG
Sbjct: 303 SRPLSSSSSSGVGG 316


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 697,898,351
Number of Sequences: 1657284
Number of extensions: 15454849
Number of successful extensions: 44437
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 42517
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 44394
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 46051731393
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).