SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0028
         (633 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q6ZT51 Cluster: CDNA FLJ44954 fis, clone BRAWH2010364; ...    54   3e-06
UniRef50_UPI0000DC2038 Cluster: UPI0000DC2038 related cluster; n...    50   4e-05
UniRef50_Q6L8H1 Cluster: Keratin-associated protein 5-4; n=160; ...    49   8e-05
UniRef50_UPI0000E22843 Cluster: PREDICTED: hypothetical protein;...    49   1e-04
UniRef50_UPI0000E22842 Cluster: PREDICTED: hypothetical protein;...    49   1e-04
UniRef50_UPI0000DD83F5 Cluster: PREDICTED: similar to keratin as...    48   1e-04
UniRef50_Q9BYR0 Cluster: Keratin-associated protein 4-7; n=149; ...    46   6e-04
UniRef50_UPI0001555AB0 Cluster: PREDICTED: hypothetical protein;...    45   0.001
UniRef50_Q4UB39 Cluster: Putative uncharacterized protein; n=5; ...    45   0.001
UniRef50_UPI000155BC4F Cluster: PREDICTED: hypothetical protein,...    45   0.002
UniRef50_UPI0000D8A05A Cluster: aaa family atpase; n=1; Eimeria ...    44   0.003
UniRef50_Q0J1G4 Cluster: Os09g0441900 protein; n=2; Oryza sativa...    44   0.004
UniRef50_P60412 Cluster: Keratin-associated protein 10-11; n=80;...    43   0.005
UniRef50_UPI0000EBDE4C Cluster: PREDICTED: similar to keratin as...    43   0.007
UniRef50_A2A4R5 Cluster: Novel member of the keratin associated ...    43   0.007
UniRef50_UPI000155F1D8 Cluster: PREDICTED: hypothetical protein;...    42   0.012
UniRef50_Q14C04 Cluster: Keratin associated protein 4-7; n=17; M...    42   0.012
UniRef50_A7TG94 Cluster: Putative metallothionein; n=2; Vanderwa...    42   0.012
UniRef50_UPI000021D9F7 Cluster: PREDICTED: similar to keratin as...    42   0.016
UniRef50_P60372 Cluster: Keratin-associated protein 10-4; n=18; ...    42   0.016
UniRef50_UPI0000EBE77C Cluster: PREDICTED: hypothetical protein;...    41   0.022
UniRef50_Q5PAM7 Cluster: Putative uncharacterized protein; n=4; ...    41   0.022
UniRef50_Q9GQC2 Cluster: Ras guanine nucleotide exchange factor ...    41   0.022
UniRef50_Q9BYR4 Cluster: Keratin-associated protein 4-3; n=53; M...    41   0.022
UniRef50_UPI00015531D6 Cluster: PREDICTED: hypothetical protein;...    41   0.028
UniRef50_UPI00006CCBE4 Cluster: hypothetical protein TTHERM_0043...    41   0.028
UniRef50_A0NCB1 Cluster: ENSANGP00000030172; n=5; Anopheles gamb...    41   0.028
UniRef50_Q6AWT8 Cluster: At5g20635; n=1; Arabidopsis thaliana|Re...    40   0.038
UniRef50_Q2I0E2 Cluster: Grain length and weight protein; n=2; O...    40   0.038
UniRef50_O14686 Cluster: Myeloid/lymphoid or mixed-lineage leuke...    40   0.038
UniRef50_UPI000155F1D6 Cluster: PREDICTED: similar to keratin as...    40   0.050
UniRef50_UPI00006A07FB Cluster: UPI00006A07FB related cluster; n...    40   0.050
UniRef50_A0TEK5 Cluster: Putative uncharacterized protein; n=1; ...    40   0.050
UniRef50_Q4UFM9 Cluster: Putative uncharacterized protein; n=2; ...    40   0.050
UniRef50_A7SFM6 Cluster: Predicted protein; n=1; Nematostella ve...    40   0.050
UniRef50_Q9ICF9 Cluster: Uncharacterized protein FPV002/FPV259; ...    40   0.050
UniRef50_UPI00015B60AD Cluster: PREDICTED: hypothetical protein;...    40   0.066
UniRef50_Q8IBA9 Cluster: Putative uncharacterized protein PF08_0...    40   0.066
UniRef50_Q7YWV7 Cluster: Putative uncharacterized protein; n=2; ...    40   0.066
UniRef50_A3LS86 Cluster: Predicted protein; n=1; Pichia stipitis...    40   0.066
UniRef50_UPI000155483C Cluster: PREDICTED: similar to keratin as...    39   0.087
UniRef50_UPI0001553357 Cluster: PREDICTED: similar to novel memb...    39   0.087
UniRef50_UPI0000E46904 Cluster: PREDICTED: similar to putative p...    39   0.087
UniRef50_Q2LXE0 Cluster: Hypothetical membrane protein; n=1; Syn...    39   0.087
UniRef50_Q4UH31 Cluster: Integral membrane protein, putative; n=...    39   0.087
UniRef50_Q17641 Cluster: Putative uncharacterized protein; n=11;...    39   0.087
UniRef50_Q6ZW48 Cluster: CDNA FLJ41609 fis, clone CTONG3001560; ...    39   0.087
UniRef50_P60410 Cluster: Keratin-associated protein 10-8; n=12; ...    39   0.087
UniRef50_P60368 Cluster: Keratin-associated protein 10-2; n=64; ...    39   0.087
UniRef50_Q95337 Cluster: Involucrin; n=11; Eutheria|Rep: Involuc...    39   0.087
UniRef50_UPI0001554838 Cluster: PREDICTED: similar to solute car...    39   0.11 
UniRef50_UPI0000E804BE Cluster: PREDICTED: hypothetical protein;...    39   0.11 
UniRef50_UPI0000D9AF71 Cluster: PREDICTED: hypothetical protein;...    39   0.11 
UniRef50_UPI0000500395 Cluster: UPI0000500395 related cluster; n...    39   0.11 
UniRef50_Q3UGM7 Cluster: Melanocyte cDNA, RIKEN full-length enri...    39   0.11 
UniRef50_Q55AK6 Cluster: U box domain-containing protein; n=3; E...    39   0.11 
UniRef50_Q54KL7 Cluster: Putative uncharacterized protein; n=1; ...    39   0.11 
UniRef50_Q4UHH6 Cluster: SfiI-subtelomeric related protein famil...    39   0.11 
UniRef50_A0DPF8 Cluster: Chromosome undetermined scaffold_59, wh...    39   0.11 
UniRef50_O96282 Cluster: Putative uncharacterized protein PFB095...    38   0.15 
UniRef50_UPI0000DB6DDB Cluster: PREDICTED: similar to nejire CG1...    38   0.20 
UniRef50_UPI0000502DB8 Cluster: UPI0000502DB8 related cluster; n...    38   0.20 
UniRef50_UPI0000E24769 Cluster: PREDICTED: keratin associated pr...    38   0.26 
UniRef50_UPI0000D8A01B Cluster: hypothetical protein e1012e08.tm...    38   0.26 
UniRef50_UPI00006CF21C Cluster: Bowman-Birk serine protease inhi...    38   0.26 
UniRef50_UPI000069F79E Cluster: Mucin-5B precursor (Mucin 5 subt...    38   0.26 
UniRef50_A2YZM6 Cluster: Putative uncharacterized protein; n=3; ...    38   0.26 
UniRef50_Q869L1 Cluster: Similar to Dictyostelium discoideum (Sl...    38   0.26 
UniRef50_Q8IUG1 Cluster: Keratin-associated protein 1-3; n=65; M...    38   0.26 
UniRef50_UPI0000DBFA3E Cluster: UPI0000DBFA3E related cluster; n...    37   0.35 
UniRef50_Q9W378 Cluster: CG12218-PA; n=2; Drosophila melanogaste...    37   0.35 
UniRef50_Q54WZ1 Cluster: Putative uncharacterized protein; n=1; ...    37   0.35 
UniRef50_Q54TE3 Cluster: Putative GATA-binding transcription fac...    37   0.35 
UniRef50_Q23H30 Cluster: Putative uncharacterized protein; n=1; ...    37   0.35 
UniRef50_O77033 Cluster: TRFA; n=2; Dictyostelium discoideum|Rep...    37   0.35 
UniRef50_A0D2J8 Cluster: Chromosome undetermined scaffold_35, wh...    37   0.35 
UniRef50_Q9H9U3 Cluster: CDNA FLJ12547 fis, clone NT2RM4000634; ...    37   0.35 
UniRef50_Q0VDU1 Cluster: Krt40 protein; n=1; Mus musculus|Rep: K...    37   0.46 
UniRef50_Q946W1 Cluster: 50kD gamma zein; n=1; Zea mays|Rep: 50k...    37   0.46 
UniRef50_A7ARU3 Cluster: Chromo-helicase DNA-binding protein, pu...    37   0.46 
UniRef50_Q6C9A9 Cluster: Similar to sp|P52958 Fusarium solani Cu...    37   0.46 
UniRef50_UPI0000DA27B8 Cluster: PREDICTED: similar to TBC1 domai...    36   0.61 
UniRef50_Q86JI7 Cluster: Similar to Homo sapiens (Human). Myotub...    36   0.61 
UniRef50_Q54HP2 Cluster: Putative uncharacterized protein; n=1; ...    36   0.61 
UniRef50_Q1JTH9 Cluster: Hyothetical protein; n=4; root|Rep: Hyo...    36   0.61 
UniRef50_A0C1S7 Cluster: Chromosome undetermined scaffold_142, w...    36   0.61 
UniRef50_A3LQZ7 Cluster: ROX1-like HMG-box transcription factor;...    36   0.61 
UniRef50_Q9BYP8 Cluster: Keratin-associated protein 17-1; n=28; ...    36   0.61 
UniRef50_UPI0001553745 Cluster: PREDICTED: similar to Keratin as...    36   0.81 
UniRef50_UPI0000F1D903 Cluster: PREDICTED: hypothetical protein;...    36   0.81 
UniRef50_UPI0000DA48D4 Cluster: PREDICTED: hypothetical protein;...    36   0.81 
UniRef50_Q3TLG6 Cluster: Mammary gland RCB-0527 Jyg-MC(B) cDNA, ...    36   0.81 
UniRef50_Q0VC31 Cluster: Keratin associated protein-like; n=5; E...    36   0.81 
UniRef50_Q9Y1T3 Cluster: Metallothionein-like protein; n=1; Jasu...    36   0.81 
UniRef50_Q9VVJ8 Cluster: CG6064-PA; n=1; Drosophila melanogaster...    36   0.81 
UniRef50_Q86AM9 Cluster: Similar to Dictyostelium discoideum (Sl...    36   0.81 
UniRef50_Q6NKN1 Cluster: RE66582p; n=4; Diptera|Rep: RE66582p - ...    36   0.81 
UniRef50_Q55G20 Cluster: Putative uncharacterized protein; n=1; ...    36   0.81 
UniRef50_Q55FL7 Cluster: Putative uncharacterized protein; n=1; ...    36   0.81 
UniRef50_Q4MYQ6 Cluster: Putative uncharacterized protein; n=4; ...    36   0.81 
UniRef50_Q8NH31 Cluster: Seven transmembrane helix receptor; n=1...    36   0.81 
UniRef50_Q5T750 Cluster: Uncharacterized protein C1orf68; n=6; E...    36   0.81 
UniRef50_Q750L9 Cluster: AGL062Cp; n=1; Eremothecium gossypii|Re...    36   0.81 
UniRef50_Q4PF35 Cluster: Putative uncharacterized protein; n=1; ...    36   0.81 
UniRef50_A7TH70 Cluster: Putative uncharacterized protein; n=1; ...    36   0.81 
UniRef50_A6ZL00 Cluster: Conserved protein; n=1; Saccharomyces c...    36   0.81 
UniRef50_Q469Q0 Cluster: Putative uncharacterized protein; n=1; ...    36   0.81 
UniRef50_Q93074 Cluster: Mediator of RNA polymerase II transcrip...    36   0.81 
UniRef50_Q75NZ4 Cluster: Low-CO2 inducible protein LCI6; n=1; Ch...    36   1.1  
UniRef50_Q556G5 Cluster: Putative uncharacterized protein; n=2; ...    36   1.1  
UniRef50_Q54DK4 Cluster: Putative uncharacterized protein ak1; n...    36   1.1  
UniRef50_Q2VJJ7 Cluster: Tes118; n=6; mojavensis species complex...    36   1.1  
UniRef50_Q19KF6 Cluster: Metallothionein; n=1; Orchesella villos...    36   1.1  
UniRef50_A0BRR4 Cluster: Chromosome undetermined scaffold_123, w...    36   1.1  
UniRef50_Q75E28 Cluster: ABL158Cp; n=1; Eremothecium gossypii|Re...    36   1.1  
UniRef50_A7TS57 Cluster: Putative uncharacterized protein; n=1; ...    36   1.1  
UniRef50_Q9CL57 Cluster: Uncharacterized protein PM1386; n=1; Pa...    36   1.1  
UniRef50_Q8WSW3 Cluster: Cadmium metallothionein precursor; n=8;...    36   1.1  
UniRef50_Q91TM5 Cluster: T71; n=1; Tupaiid herpesvirus 1|Rep: T7...    35   1.4  
UniRef50_A2A4M7 Cluster: Novel member of the keratin associated ...    35   1.4  
UniRef50_Q7KWV9 Cluster: Similar to Dictyostelium discoideum (Sl...    35   1.4  
UniRef50_Q70LQ4 Cluster: Cysteine-rich protein; n=2; Enchytraeus...    35   1.4  
UniRef50_Q54YK3 Cluster: Putative uncharacterized protein; n=1; ...    35   1.4  
UniRef50_Q54U49 Cluster: Putative uncharacterized protein; n=2; ...    35   1.4  
UniRef50_Q54LZ1 Cluster: Putative uncharacterized protein; n=1; ...    35   1.4  
UniRef50_Q4V4J0 Cluster: IP04080p; n=1; Drosophila melanogaster|...    35   1.4  
UniRef50_Q23CT2 Cluster: Putative uncharacterized protein; n=1; ...    35   1.4  
UniRef50_Q6CPW4 Cluster: Similarities with sp|Q03825 Saccharomyc...    35   1.4  
UniRef50_Q4PHZ9 Cluster: Putative uncharacterized protein; n=1; ...    35   1.4  
UniRef50_Q9VDR1 Cluster: Mediator of RNA polymerase II transcrip...    35   1.4  
UniRef50_UPI00015B4328 Cluster: PREDICTED: similar to DNA bindin...    35   1.9  
UniRef50_UPI0000E4956C Cluster: PREDICTED: similar to MondoA; n=...    35   1.9  
UniRef50_Q3WCX6 Cluster: Similar to ATPase; n=2; Actinomycetales...    35   1.9  
UniRef50_A5C3P9 Cluster: Putative uncharacterized protein; n=2; ...    35   1.9  
UniRef50_Q9VSJ0 Cluster: Ecdysone-inducible gene E1; n=4; Drosop...    35   1.9  
UniRef50_Q86AF2 Cluster: Similar to Dictyostelium discoideum (Sl...    35   1.9  
UniRef50_Q5CRJ9 Cluster: Ubiquitin C-terminal hydrolase of the c...    35   1.9  
UniRef50_Q54JH9 Cluster: Putative uncharacterized protein; n=2; ...    35   1.9  
UniRef50_Q54GP2 Cluster: Putative uncharacterized protein; n=1; ...    35   1.9  
UniRef50_Q4UHZ5 Cluster: Putative uncharacterized protein; n=2; ...    35   1.9  
UniRef50_Q4U8N7 Cluster: Hypothetical product; n=4; Theileria|Re...    35   1.9  
UniRef50_Q2KPA5 Cluster: Clock; n=1; Macrobrachium rosenbergii|R...    35   1.9  
UniRef50_Q236J9 Cluster: Leishmanolysin family protein; n=1; Tet...    35   1.9  
UniRef50_Q23390 Cluster: Putative uncharacterized protein pqn-95...    35   1.9  
UniRef50_A0C230 Cluster: Chromosome undetermined scaffold_143, w...    35   1.9  
UniRef50_Q5A188 Cluster: Putative uncharacterized protein; n=2; ...    35   1.9  
UniRef50_P15618 Cluster: Uncharacterized mitochondrial protein O...    35   1.9  
UniRef50_UPI00015B58BD Cluster: PREDICTED: hypothetical protein;...    34   2.5  
UniRef50_UPI0000499BF3 Cluster: hypothetical protein 151.t00004;...    34   2.5  
UniRef50_UPI0000D8B557 Cluster: UPI0000D8B557 related cluster; n...    34   2.5  
UniRef50_Q6GZT3 Cluster: Putative uncharacterized protein; n=1; ...    34   2.5  
UniRef50_Q61118 Cluster: Glutamine repeat protein-1; n=5; Eukary...    34   2.5  
UniRef50_Q3TS98 Cluster: In vitro fertilized eggs cDNA, RIKEN fu...    34   2.5  
UniRef50_Q0LEI4 Cluster: Putative expression regulator; n=1; Her...    34   2.5  
UniRef50_Q9XUS0 Cluster: Putative uncharacterized protein; n=2; ...    34   2.5  
UniRef50_Q5TR79 Cluster: ENSANGP00000025827; n=1; Anopheles gamb...    34   2.5  
UniRef50_Q554Z4 Cluster: Histidine kinase; n=3; Dictyostelium di...    34   2.5  
UniRef50_Q54VU4 Cluster: Putative uncharacterized protein; n=2; ...    34   2.5  
UniRef50_Q54UJ3 Cluster: Paired amphipathic helix (PAH) containi...    34   2.5  
UniRef50_Q54FZ7 Cluster: Putative uncharacterized protein; n=4; ...    34   2.5  
UniRef50_A0C569 Cluster: Chromosome undetermined scaffold_15, wh...    34   2.5  
UniRef50_Q7S0G4 Cluster: Putative uncharacterized protein NCU094...    34   2.5  
UniRef50_P48998 Cluster: Involucrin; n=3; Rattus norvegicus|Rep:...    34   2.5  
UniRef50_UPI0001553704 Cluster: PREDICTED: hypothetical protein;...    34   3.3  
UniRef50_UPI0000F21390 Cluster: PREDICTED: hypothetical protein;...    34   3.3  
UniRef50_UPI00006DC8E1 Cluster: hypothetical protein CdifQ_04002...    34   3.3  
UniRef50_UPI0000611EB5 Cluster: Proline rich 9.; n=2; Gallus gal...    34   3.3  
UniRef50_Q102G1 Cluster: Progranulin; n=2; Oreochromis mossambic...    34   3.3  
UniRef50_A2A5X5 Cluster: Ortholog of keratin associated protein ...    34   3.3  
UniRef50_Q8ZRX7 Cluster: Putative viral protein; n=1; Salmonella...    34   3.3  
UniRef50_A1H7M9 Cluster: Uncharacterized protein possibly involv...    34   3.3  
UniRef50_Q9VUB7 Cluster: CG32133-PA; n=1; Drosophila melanogaste...    34   3.3  
UniRef50_Q54D50 Cluster: Putative uncharacterized protein; n=1; ...    34   3.3  
UniRef50_Q22XN6 Cluster: Thioredoxin family protein; n=2; Alveol...    34   3.3  
UniRef50_Q0E901 Cluster: CG30389-PA, isoform A; n=6; Coelomata|R...    34   3.3  
UniRef50_A0DGM1 Cluster: Chromosome undetermined scaffold_5, who...    34   3.3  
UniRef50_A0C549 Cluster: Chromosome undetermined scaffold_15, wh...    34   3.3  
UniRef50_Q7SEI9 Cluster: Predicted protein; n=1; Neurospora cras...    34   3.3  
UniRef50_Q4WMY7 Cluster: Putative uncharacterized protein; n=3; ...    34   3.3  
UniRef50_A6SKS7 Cluster: Putative uncharacterized protein; n=2; ...    34   3.3  
UniRef50_P13709 Cluster: Homeotic protein female sterile; n=4; D...    34   3.3  
UniRef50_UPI000155D188 Cluster: PREDICTED: similar to TatD DNase...    33   4.3  
UniRef50_UPI0000E49085 Cluster: PREDICTED: similar to keratin as...    33   4.3  
UniRef50_UPI0000E47460 Cluster: PREDICTED: hypothetical protein;...    33   4.3  
UniRef50_Q4T8W5 Cluster: Chromosome undetermined SCAF7713, whole...    33   4.3  
UniRef50_Q08B86 Cluster: Zgc:154176; n=5; Clupeocephala|Rep: Zgc...    33   4.3  
UniRef50_O93321 Cluster: All-1 related protein; n=2; Takifugu ru...    33   4.3  
UniRef50_Q0JLD3 Cluster: Os01g0607400 protein; n=16; Magnoliophy...    33   4.3  
UniRef50_Q9W483 Cluster: CG15772-PA; n=2; Sophophora|Rep: CG1577...    33   4.3  
UniRef50_Q9GSL4 Cluster: ZFH-2; n=1; Trichinella spiralis|Rep: Z...    33   4.3  
UniRef50_Q7REV3 Cluster: Drosophila melanogaster CG8797 gene pro...    33   4.3  
UniRef50_Q6T872 Cluster: DIF insensitive mutant A; n=2; Dictyost...    33   4.3  
UniRef50_Q556F5 Cluster: C2H2 type Zn finger-containing protein;...    33   4.3  
UniRef50_Q54ZP4 Cluster: Putative uncharacterized protein dyrk1;...    33   4.3  
UniRef50_Q54PJ4 Cluster: Putative uncharacterized protein; n=1; ...    33   4.3  
UniRef50_Q54K82 Cluster: Putative uncharacterized protein; n=1; ...    33   4.3  
UniRef50_Q3YL58 Cluster: Mantle gene 8; n=1; Pinctada fucata|Rep...    33   4.3  
UniRef50_Q17316 Cluster: Putative uncharacterized protein; n=1; ...    33   4.3  
UniRef50_A7SLJ5 Cluster: Predicted protein; n=1; Nematostella ve...    33   4.3  
UniRef50_A7SE38 Cluster: Predicted protein; n=1; Nematostella ve...    33   4.3  
UniRef50_A7S8Y9 Cluster: Predicted protein; n=1; Nematostella ve...    33   4.3  
UniRef50_A2FY74 Cluster: Putative uncharacterized protein; n=1; ...    33   4.3  
UniRef50_A0DYG7 Cluster: Chromosome undetermined scaffold_7, who...    33   4.3  
UniRef50_A0C9C7 Cluster: Chromosome undetermined scaffold_16, wh...    33   4.3  
UniRef50_Q6BS91 Cluster: Similarities with CA0749|CaHAP5 Candida...    33   4.3  
UniRef50_Q6BKL5 Cluster: Similarities with CA4511|IPF8966 Candid...    33   4.3  
UniRef50_Q5KMV6 Cluster: Putative uncharacterized protein; n=1; ...    33   4.3  
UniRef50_Q55X27 Cluster: Putative uncharacterized protein; n=1; ...    33   4.3  
UniRef50_Q0U994 Cluster: Putative uncharacterized protein; n=1; ...    33   4.3  
UniRef50_Q0CRX6 Cluster: Predicted protein; n=1; Aspergillus ter...    33   4.3  
UniRef50_A5E351 Cluster: Putative uncharacterized protein; n=1; ...    33   4.3  
UniRef50_A5DV45 Cluster: Putative uncharacterized protein; n=1; ...    33   4.3  
UniRef50_Q01644 Cluster: Male-specific sperm protein Mst84Dc; n=...    33   4.3  
UniRef50_UPI0000F2CDA9 Cluster: PREDICTED: hypothetical protein;...    33   5.7  
UniRef50_UPI0000F2CAEF Cluster: PREDICTED: similar to novel KRAB...    33   5.7  
UniRef50_UPI0000DA38DA Cluster: PREDICTED: similar to Zinc finge...    33   5.7  
UniRef50_UPI0000DA37F3 Cluster: PREDICTED: similar to Zinc finge...    33   5.7  
UniRef50_UPI0000546B3D Cluster: PREDICTED: hypothetical protein;...    33   5.7  
UniRef50_UPI0000F319E5 Cluster: CDNA FLJ12547 fis, clone NT2RM40...    33   5.7  
UniRef50_Q4SHQ6 Cluster: Chromosome 5 SCAF14581, whole genome sh...    33   5.7  
UniRef50_Q9DA33 Cluster: Adult male testis cDNA, RIKEN full-leng...    33   5.7  
UniRef50_A0LHU6 Cluster: Putative chromosome segregation ATPase ...    33   5.7  
UniRef50_Q0Q5D1 Cluster: Protein kinase; n=10; BEP clade|Rep: Pr...    33   5.7  
UniRef50_Q8LTG6 Cluster: Mitogen; n=1; Streptococcus phage phisc...    33   5.7  
UniRef50_Q9VED3 Cluster: CG7847-PA, isoform A; n=5; Drosophila|R...    33   5.7  
UniRef50_Q9TY01 Cluster: Prion-like-(Q/n-rich)-domain-bearing pr...    33   5.7  
UniRef50_Q55CH1 Cluster: Putative uncharacterized protein; n=1; ...    33   5.7  
UniRef50_Q54WP5 Cluster: Putative glycosyltransferase; n=1; Dict...    33   5.7  
UniRef50_Q54WI5 Cluster: SAP DNA-binding domain-containing prote...    33   5.7  
UniRef50_Q54VY9 Cluster: Putative uncharacterized protein; n=1; ...    33   5.7  
UniRef50_Q54V91 Cluster: Putative uncharacterized protein; n=1; ...    33   5.7  
UniRef50_Q54BK4 Cluster: Putative uncharacterized protein; n=1; ...    33   5.7  
UniRef50_Q23847 Cluster: Glutamine-asparagine rich protein; n=2;...    33   5.7  
UniRef50_Q22HG6 Cluster: Mov34/MPN/PAD-1 family protein; n=1; Te...    33   5.7  
UniRef50_A7S9V6 Cluster: Predicted protein; n=1; Nematostella ve...    33   5.7  
UniRef50_A7RLU4 Cluster: Predicted protein; n=3; Eukaryota|Rep: ...    33   5.7  
UniRef50_A2FSM2 Cluster: Putative uncharacterized protein; n=1; ...    33   5.7  
UniRef50_A0EHS3 Cluster: Chromosome undetermined scaffold_97, wh...    33   5.7  
UniRef50_A0DWE3 Cluster: Chromosome undetermined scaffold_67, wh...    33   5.7  
UniRef50_A0D240 Cluster: Chromosome undetermined scaffold_35, wh...    33   5.7  
UniRef50_A0BBG4 Cluster: Chromosome undetermined scaffold_1, who...    33   5.7  
UniRef50_Q5XIY8 Cluster: PAX-interacting protein 1; n=3; Danio r...    33   5.7  
UniRef50_P36417 Cluster: G-box-binding factor; n=3; Dictyosteliu...    33   5.7  
UniRef50_UPI0001554BDF Cluster: PREDICTED: similar to tumor prot...    33   7.5  
UniRef50_UPI0000E48D50 Cluster: PREDICTED: similar to neurogenic...    33   7.5  
UniRef50_UPI0000E2275A Cluster: PREDICTED: hypothetical protein;...    33   7.5  
UniRef50_UPI0000DB709E Cluster: PREDICTED: similar to corto CG25...    33   7.5  
UniRef50_UPI0000D62322 Cluster: Keratin-associated protein 1-5 (...    33   7.5  
UniRef50_Q8QNJ9 Cluster: EsV-1-74; n=1; Ectocarpus siliculosus v...    33   7.5  
UniRef50_A3QTQ8 Cluster: ORF99; n=3; Koi herpesvirus|Rep: ORF99 ...    33   7.5  
UniRef50_Q9PC33 Cluster: Chemotaxis-related protein kinase; n=5;...    33   7.5  
UniRef50_Q9K9T4 Cluster: BH2561 protein; n=1; Bacillus haloduran...    33   7.5  
UniRef50_Q21KJ6 Cluster: Putative uncharacterized protein; n=1; ...    33   7.5  
UniRef50_A0HCG3 Cluster: Putative uncharacterized protein precur...    33   7.5  
UniRef50_A0FYB0 Cluster: Putative uncharacterized protein; n=1; ...    33   7.5  
UniRef50_Q5BPU6 Cluster: Putative uncharacterized protein; n=1; ...    33   7.5  
UniRef50_A7PDU4 Cluster: Chromosome chr11 scaffold_13, whole gen...    33   7.5  
UniRef50_Q967R6 Cluster: Cytoplasmic polyadenylation element-bin...    33   7.5  
UniRef50_Q8T151 Cluster: Similar to Vibrio vulnificus CMCP6. TPR...    33   7.5  
UniRef50_Q86HS5 Cluster: Similar to Vibrio vulnificus CMCP6. TPR...    33   7.5  
UniRef50_Q7R1M3 Cluster: GLP_28_55053_59060; n=1; Giardia lambli...    33   7.5  
UniRef50_Q611V7 Cluster: Putative uncharacterized protein CBG169...    33   7.5  
UniRef50_Q5EGE0 Cluster: Putative metal-inducible metallothionei...    33   7.5  
UniRef50_Q5CWQ9 Cluster: Putative uncharacterized protein; n=3; ...    33   7.5  
UniRef50_Q5CL64 Cluster: Putative uncharacterized protein; n=2; ...    33   7.5  
UniRef50_Q55BL8 Cluster: Putative uncharacterized protein; n=1; ...    33   7.5  
UniRef50_Q558Y5 Cluster: Putative uncharacterized protein; n=4; ...    33   7.5  
UniRef50_Q553G4 Cluster: Putative uncharacterized protein; n=2; ...    33   7.5  
UniRef50_Q54X94 Cluster: Putative uncharacterized protein; n=1; ...    33   7.5  
UniRef50_Q54UG3 Cluster: SAP DNA-binding domain-containing prote...    33   7.5  
UniRef50_Q54QC7 Cluster: Putative uncharacterized protein; n=1; ...    33   7.5  
UniRef50_Q54BD4 Cluster: Transcriptional repressor; n=2; Dictyos...    33   7.5  
UniRef50_Q4N727 Cluster: Putative uncharacterized protein; n=1; ...    33   7.5  
UniRef50_Q24FU9 Cluster: Putative uncharacterized protein; n=1; ...    33   7.5  
UniRef50_Q20000 Cluster: Putative uncharacterized protein; n=2; ...    33   7.5  
UniRef50_A7TD32 Cluster: Predicted protein; n=1; Nematostella ve...    33   7.5  
UniRef50_A0E383 Cluster: Chromosome undetermined scaffold_76, wh...    33   7.5  
UniRef50_A0DXG6 Cluster: Chromosome undetermined scaffold_68, wh...    33   7.5  
UniRef50_A0DIZ9 Cluster: Chromosome undetermined scaffold_52, wh...    33   7.5  
UniRef50_Q9NSI5 Cluster: IGSF5 protein; n=4; Catarrhini|Rep: IGS...    33   7.5  
UniRef50_Q8X0K6 Cluster: Putative uncharacterized protein B11B23...    33   7.5  
UniRef50_Q7SDQ3 Cluster: Putative uncharacterized protein NCU028...    33   7.5  
UniRef50_Q6CUE4 Cluster: Kluyveromyces lactis strain NRRL Y-1140...    33   7.5  
UniRef50_Q5KNZ9 Cluster: Putative uncharacterized protein; n=1; ...    33   7.5  
UniRef50_Q5TA78 Cluster: Late cornified envelope protein 4A; n=2...    33   7.5  
UniRef50_Q9HE93 Cluster: Putative uncharacterized protein B13O20...    26   9.3  
UniRef50_UPI00015B56AD Cluster: PREDICTED: similar to conserved ...    32   10.0 
UniRef50_UPI0000DA31E2 Cluster: PREDICTED: hypothetical protein;...    32   10.0 
UniRef50_UPI0000DA2443 Cluster: PREDICTED: similar to dual oxida...    32   10.0 
UniRef50_UPI00006CD1E3 Cluster: Insect antifreeze protein; n=1; ...    32   10.0 
UniRef50_UPI0000498A4B Cluster: calponin homology domain protein...    32   10.0 
UniRef50_UPI0000195B86 Cluster: PREDICTED: hypothetical protein ...    32   10.0 
UniRef50_UPI00005664BF Cluster: UPI00005664BF related cluster; n...    32   10.0 
UniRef50_UPI00006607C2 Cluster: UPI00006607C2 related cluster; n...    32   10.0 
UniRef50_UPI0000F34756 Cluster: IgGFc-binding protein precursor ...    32   10.0 
UniRef50_Q5L037 Cluster: Putative uncharacterized protein GK1414...    32   10.0 
UniRef50_Q7XWP6 Cluster: OSJNBa0072D08.4 protein; n=5; Oryza sat...    32   10.0 
UniRef50_Q011K3 Cluster: Predicted E3 ubiquitin ligase; n=1; Ost...    32   10.0 
UniRef50_Q9VI93 Cluster: CG32466-PA, isoform A; n=6; Diptera|Rep...    32   10.0 
UniRef50_Q9GRA9 Cluster: Master of thick veins; n=11; Fungi/Meta...    32   10.0 
UniRef50_Q86P48 Cluster: SD17309p; n=2; Drosophila melanogaster|...    32   10.0 
UniRef50_Q867Z5 Cluster: Gag protein; n=1; Drosophila virilis|Re...    32   10.0 
UniRef50_Q5TMX4 Cluster: ENSANGP00000028367; n=1; Anopheles gamb...    32   10.0 
UniRef50_Q5CVA1 Cluster: Large protein with 2 MYB domains plus l...    32   10.0 
UniRef50_Q5CQE7 Cluster: Putative uncharacterized protein; n=1; ...    32   10.0 
UniRef50_Q57UB3 Cluster: Putative uncharacterized protein; n=1; ...    32   10.0 
UniRef50_Q54YV0 Cluster: Putative uncharacterized protein; n=1; ...    32   10.0 
UniRef50_Q54YJ4 Cluster: Putative uncharacterized protein; n=1; ...    32   10.0 
UniRef50_Q54XA8 Cluster: Putative uncharacterized protein; n=1; ...    32   10.0 
UniRef50_Q54PB3 Cluster: Putative uncharacterized protein; n=1; ...    32   10.0 
UniRef50_Q4V6Z5 Cluster: IP01358p; n=1; Drosophila melanogaster|...    32   10.0 
UniRef50_Q23ZG3 Cluster: Putative uncharacterized protein; n=1; ...    32   10.0 
UniRef50_Q22RJ4 Cluster: Putative uncharacterized protein; n=1; ...    32   10.0 
UniRef50_A7T2G6 Cluster: Predicted protein; n=2; Nematostella ve...    32   10.0 
UniRef50_A7SW02 Cluster: Predicted protein; n=1; Nematostella ve...    32   10.0 
UniRef50_A7S6R9 Cluster: Predicted protein; n=1; Nematostella ve...    32   10.0 
UniRef50_A4IJ82 Cluster: LD40879p; n=6; Drosophila melanogaster|...    32   10.0 
UniRef50_A0DPX9 Cluster: Chromosome undetermined scaffold_6, who...    32   10.0 
UniRef50_A0D7R8 Cluster: Chromosome undetermined scaffold_40, wh...    32   10.0 
UniRef50_A0D688 Cluster: Chromosome undetermined scaffold_391, w...    32   10.0 
UniRef50_A0CRQ4 Cluster: Chromosome undetermined scaffold_25, wh...    32   10.0 
UniRef50_Q6ZQS2 Cluster: CDNA FLJ45585 fis, clone BRTHA3013882; ...    32   10.0 
UniRef50_Q7SDQ7 Cluster: Putative uncharacterized protein NCU028...    32   10.0 
UniRef50_Q7S8P5 Cluster: Putative uncharacterized protein NCU086...    32   10.0 
UniRef50_Q7RWY3 Cluster: Predicted protein; n=1; Neurospora cras...    32   10.0 
UniRef50_Q6C308 Cluster: Yarrowia lipolytica chromosome F of str...    32   10.0 
UniRef50_Q5KNA4 Cluster: Putative uncharacterized protein; n=1; ...    32   10.0 
UniRef50_Q0UC75 Cluster: Putative uncharacterized protein; n=1; ...    32   10.0 
UniRef50_A7TI39 Cluster: Putative uncharacterized protein; n=1; ...    32   10.0 
UniRef50_A5E5Q7 Cluster: Predicted protein; n=1; Lodderomyces el...    32   10.0 
UniRef50_Q8TBZ5 Cluster: Zinc finger protein 502; n=5; Eutheria|...    32   10.0 
UniRef50_O15405 Cluster: TOX high mobility group box family memb...    32   10.0 
UniRef50_P29617 Cluster: Protein prospero; n=10; Coelomata|Rep: ...    32   10.0 
UniRef50_Q05568 Cluster: Peroxisome assembly protein 10; n=3; Sa...    32   10.0 
UniRef50_O61735 Cluster: Circadian locomoter output cycles prote...    32   10.0 
UniRef50_Q24266 Cluster: Transcription factor btd; n=2; Drosophi...    32   10.0 

>UniRef50_Q6ZT51 Cluster: CDNA FLJ44954 fis, clone BRAWH2010364;
           n=3; Homo sapiens|Rep: CDNA FLJ44954 fis, clone
           BRAWH2010364 - Homo sapiens (Human)
          Length = 247

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 34/88 (38%), Positives = 41/88 (46%), Gaps = 4/88 (4%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGI---LCCFAILCWCCSNPASGSLHSPCS- 421
           C S+ CS  C+L C+ CCS +C   C P   +    CCF     CCS    GSLH  CS 
Sbjct: 105 CCSLRCSPCCSLHCSPCCSLQCSLHCSPHCSLHCSPCCFLHRSPCCS--LQGSLH--CSP 160

Query: 422 CCICCRLPIWSSTSSTFPVWICTSVCSI 505
           CC   R P  S   S      C+  CS+
Sbjct: 161 CCFLHRSPCCSLQGSLH----CSPCCSL 184



 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 26/65 (40%), Positives = 30/65 (46%), Gaps = 2/65 (3%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCS--CC 427
           C S+ CS  C+L C+ CCS RC + CC      CC      CCS   S      CS  C 
Sbjct: 81  CCSLRCSPCCSLHCSPCCSLRC-SPCCSLRCSPCCSLHCSPCCSLQCSLHCSPHCSLHCS 139

Query: 428 ICCRL 442
            CC L
Sbjct: 140 PCCFL 144



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 30/72 (41%), Positives = 37/72 (51%), Gaps = 1/72 (1%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCS-CCI 430
           C S+ CS  C+LRC+ CCS RC + CC      CC ++ C    +P   SLH  CS CC 
Sbjct: 89  CCSLHCSPCCSLRCSPCCSLRC-SPCCSLHCSPCC-SLQCSLHCSPHC-SLH--CSPCCF 143

Query: 431 CCRLPIWSSTSS 466
             R P  S   S
Sbjct: 144 LHRSPCCSLQGS 155



 Score = 46.0 bits (104), Expect = 8e-04
 Identities = 35/89 (39%), Positives = 41/89 (46%), Gaps = 16/89 (17%)
 Frame = +2

Query: 248 PLCN---SICCSYSCTLRCTFCCSNRCG-------TSCCPSSGIL----CCFAILCWCCS 385
           P C+   S CCS  C+L C+  CS  C        + CC   G L    CCF     CCS
Sbjct: 112 PCCSLHCSPCCSLQCSLHCSPHCSLHCSPCCFLHRSPCCSLQGSLHCSPCCFLHRSPCCS 171

Query: 386 NPASGSLH-SP-CSCCICCRLPIWSSTSS 466
               GSLH SP CS  I C  P  S T++
Sbjct: 172 --LQGSLHCSPCCSLHISCPRPSHSPTNT 198



 Score = 42.7 bits (96), Expect = 0.007
 Identities = 26/62 (41%), Positives = 31/62 (50%), Gaps = 1/62 (1%)
 Frame = +2

Query: 260 SICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLH-SPCSCCICC 436
           S+ CS  C+LRC+ CCS  C + CC      CC      CC      SLH SPC C + C
Sbjct: 75  SLHCSPCCSLRCSPCCSLHC-SPCCSLRCSPCCSLRCSPCC------SLHCSPC-CSLQC 126

Query: 437 RL 442
            L
Sbjct: 127 SL 128


>UniRef50_UPI0000DC2038 Cluster: UPI0000DC2038 related cluster; n=1;
           Rattus norvegicus|Rep: UPI0000DC2038 UniRef100 entry -
           Rattus norvegicus
          Length = 184

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 25/84 (29%), Positives = 33/84 (39%), Gaps = 2/84 (2%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGS--LHSPCSCC 427
           C  +CC+  C   C  CC   C    C S    CC  + C C     +GS  ++  C CC
Sbjct: 59  CRGLCCAKGCCCHCC-CCYCCCAPVACSSE---CCQPVQCQCIQVSCAGSYCVNGNCCCC 114

Query: 428 ICCRLPIWSSTSSTFPVWICTSVC 499
            CC  P +          +C  VC
Sbjct: 115 CCC-FPNYRPDCLCSYCCVCECVC 137



 Score = 38.3 bits (85), Expect = 0.15
 Identities = 26/79 (32%), Positives = 31/79 (39%), Gaps = 4/79 (5%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSC----CPSSGILCCFAILCWCCSNPASGSLHSPCS 421
           C   C S+ C  +C   C N    +C    CPSS    C A  C CC           C 
Sbjct: 26  CFPYCLSFQC-FKCLILCRNPSCQTCLHHWCPSSCRGLCCAKGC-CCH----------CC 73

Query: 422 CCICCRLPIWSSTSSTFPV 478
           CC CC  P+  S+    PV
Sbjct: 74  CCYCCCAPVACSSECCQPV 92



 Score = 35.5 bits (78), Expect = 1.1
 Identities = 19/62 (30%), Positives = 23/62 (37%), Gaps = 3/62 (4%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNP--ASGSLHSPCSC- 424
           C  +C + SC       C + C   CC      CC    C+CC  P   S     P  C 
Sbjct: 38  CLILCRNPSCQTCLHHWCPSSCRGLCCAKG--CCCHCCCCYCCCAPVACSSECCQPVQCQ 95

Query: 425 CI 430
           CI
Sbjct: 96  CI 97



 Score = 32.7 bits (71), Expect = 7.5
 Identities = 22/65 (33%), Positives = 24/65 (36%), Gaps = 4/65 (6%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGT-SCCPSSGILCCFAILCWCCSNPASGSLHSPC-SCC 427
           C   CC   C  R   CC  RC    C P      CF  L  C +      LH  C S C
Sbjct: 1   CCCCCCCCCCRRRRRCCCC-RCNVLFCFPYCLSFQCFKCLILCRNPSCQTCLHHWCPSSC 59

Query: 428 --ICC 436
             +CC
Sbjct: 60  RGLCC 64


>UniRef50_Q6L8H1 Cluster: Keratin-associated protein 5-4; n=160;
           Fungi/Metazoa group|Rep: Keratin-associated protein 5-4
           - Homo sapiens (Human)
          Length = 288

 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 29/65 (44%), Positives = 33/65 (50%), Gaps = 3/65 (4%)
 Frame = +2

Query: 254 CNSICCSY-SCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC- 427
           C S  CS  SC   C  CCS+ CG+SCC SS   CC      CCS+   GS     SCC 
Sbjct: 191 CGSCGCSQCSCCKPC--CCSSGCGSSCCQSS---CCKP----CCSSSGCGSSCCQSSCCK 241

Query: 428 -ICCR 439
             CC+
Sbjct: 242 PYCCQ 246



 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 29/66 (43%), Positives = 33/66 (50%), Gaps = 5/66 (7%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRC-GTSCCPSSGI--LCCFAILCW-CCSNPASGSLHSPCS 421
           C S CC  SC   C  CCS+   G+SCC SS     CC +  C  CCS+   GS     S
Sbjct: 211 CGSSCCQSSC---CKPCCSSSGCGSSCCQSSCCKPYCCQSSCCKPCCSSSGCGSSCCQSS 267

Query: 422 CC-ICC 436
           CC  CC
Sbjct: 268 CCNPCC 273



 Score = 37.5 bits (83), Expect = 0.26
 Identities = 16/44 (36%), Positives = 20/44 (45%), Gaps = 2/44 (4%)
 Frame = +2

Query: 254 CNSICCSYSCTLR-C-TFCCSNRCGTSCCPSSGILCCFAILCWC 379
           C S CC   C+   C + CC + C   CC  S   CC  + C C
Sbjct: 245 CQSSCCKPCCSSSGCGSSCCQSSCCNPCCSQSS--CCVPVCCQC 286


>UniRef50_UPI0000E22843 Cluster: PREDICTED: hypothetical protein;
           n=1; Pan troglodytes|Rep: PREDICTED: hypothetical
           protein - Pan troglodytes
          Length = 304

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 33/89 (37%), Positives = 40/89 (44%), Gaps = 5/89 (5%)
 Frame = +2

Query: 254 CNSICCSY-SCTLRCTFCCSNRCGTSCCPSSGI--LCCFAILC--WCCSNPASGSLHSPC 418
           C S  CS  SC   C  CCS+ CG+SCC SS     CC +  C  +CC +    S   PC
Sbjct: 216 CGSYGCSQCSCCKPC--CCSSGCGSSCCQSSCCKPYCCQSSCCKPYCCQS----SCCKPC 269

Query: 419 SCCICCRLPIWSSTSSTFPVWICTSVCSI 505
           SC   C        SS +    C S C +
Sbjct: 270 SCSSGCGSS--CCQSSCYKPCCCQSSCCV 296



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 25/68 (36%), Positives = 31/68 (45%), Gaps = 3/68 (4%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCC-SNRCGTSCCPSSGILCCFAILC--WCCSNPASGSLHSPCSC 424
           C S CC  SC     +CC S+ C   CC SS   CC    C   C S+    S + PC C
Sbjct: 236 CGSSCCQSSCCK--PYCCQSSCCKPYCCQSS---CCKPCSCSSGCGSSCCQSSCYKPCCC 290

Query: 425 CICCRLPI 448
              C +P+
Sbjct: 291 QSSCCVPV 298



 Score = 39.1 bits (87), Expect = 0.087
 Identities = 27/78 (34%), Positives = 30/78 (38%), Gaps = 3/78 (3%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRC-GTSCCPSSGILCCFAILCW-CCSNPASGSLHSPCSCC 427
           C   CCS  C    + CC + C    CC SS   CC    C   C  P S S     SCC
Sbjct: 227 CKPCCCSSGCG---SSCCQSSCCKPYCCQSS---CCKPYCCQSSCCKPCSCSSGCGSSCC 280

Query: 428 -ICCRLPIWSSTSSTFPV 478
              C  P    +S   PV
Sbjct: 281 QSSCYKPCCCQSSCCVPV 298


>UniRef50_UPI0000E22842 Cluster: PREDICTED: hypothetical protein;
           n=2; Mammalia|Rep: PREDICTED: hypothetical protein - Pan
           troglodytes
          Length = 298

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 34/85 (40%), Positives = 40/85 (47%), Gaps = 3/85 (3%)
 Frame = +2

Query: 254 CNSICCSY-SCTLRCTFCCSNRCGTSCCPSSGIL-CCFAILCWCCSNPASGSLHSP-CSC 424
           C S  CS  SC   C  CCS+ CG+SCC SS     C    C C S+    S   P CS 
Sbjct: 121 CGSCGCSQCSCYKPC--CCSSGCGSSCCQSSCCKPSCSQSSCCCGSSCCQSSCCKPSCSQ 178

Query: 425 CICCRLPIWSSTSSTFPVWICTSVC 499
             CC+ P  S +S   P   C+S C
Sbjct: 179 SSCCK-PCCSQSSCCKPC-SCSSGC 201



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 32/87 (36%), Positives = 38/87 (43%), Gaps = 5/87 (5%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCC-PSSGILCCFAILC--WCCSNPASGSLHSPCSC 424
           C S CC  SC+     C S+ C +SCC PS     C    C    C  P S S     SC
Sbjct: 146 CQSSCCKPSCSQSSCCCGSSCCQSSCCKPSCSQSSCCKPCCSQSSCCKPCSCSSGCGSSC 205

Query: 425 C--ICCRLPIWSSTSSTFPVWICTSVC 499
           C   CC+ P  S +S   P   C+S C
Sbjct: 206 CQSNCCK-PCCSQSSCCKPC-CCSSGC 230



 Score = 46.0 bits (104), Expect = 8e-04
 Identities = 33/101 (32%), Positives = 42/101 (41%), Gaps = 10/101 (9%)
 Frame = +2

Query: 227 RPSLLP*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGIL-CCFAILCW--CCSNPAS 397
           +PS      C   C   SC   C+  CS+ CG+SCC S+    CC    C   CC +   
Sbjct: 173 KPSCSQSSCCKPCCSQSSCCKPCS--CSSGCGSSCCQSNCCKPCCSQSSCCKPCCCSSGC 230

Query: 398 GSLHSPCSCC-------ICCRLPIWSSTSSTFPVWICTSVC 499
           GS     SCC        CC+ P  S +    P   C+S C
Sbjct: 231 GSSCCQSSCCKPSCSQSSCCK-PCCSQSRCCKPC-CCSSGC 269



 Score = 40.7 bits (91), Expect = 0.028
 Identities = 24/64 (37%), Positives = 26/64 (40%), Gaps = 3/64 (4%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGIL-CCFAILCW--CCSNPASGSLHSPCSC 424
           C   CCS  C   C  C S+ C  SC  SS    CC    C   CC +   GS     SC
Sbjct: 221 CKPCCCSSGCGSSC--CQSSCCKPSCSQSSCCKPCCSQSRCCKPCCCSSGCGSSCCQSSC 278

Query: 425 CICC 436
           C  C
Sbjct: 279 CKPC 282



 Score = 40.3 bits (90), Expect = 0.038
 Identities = 25/60 (41%), Positives = 30/60 (50%), Gaps = 1/60 (1%)
 Frame = +2

Query: 254 CNSICCSYS-CTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCI 430
           C   CCS S C   C  CCS+ CG+SCC SS   CC       CS+ +S  +   C C I
Sbjct: 249 CCKPCCSQSRCCKPC--CCSSGCGSSCCQSS---CCKP-----CSSQSSCCVPICCQCKI 298



 Score = 35.1 bits (77), Expect = 1.4
 Identities = 19/69 (27%), Positives = 24/69 (34%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCIC 433
           C S CC   C  +   CC   C  S C S G      + C  C         S   C   
Sbjct: 31  CGSGCCVPVCCCKPVCCCVPACSCSSCGSCGGSKGVCVPCGGCKGGCGSCGGSKGGCGSS 90

Query: 434 CRLPIWSST 460
           C +P+  S+
Sbjct: 91  CCVPVCCSS 99


>UniRef50_UPI0000DD83F5 Cluster: PREDICTED: similar to keratin
           associated protein 9.2; n=1; Homo sapiens|Rep:
           PREDICTED: similar to keratin associated protein 9.2 -
           Homo sapiens
          Length = 301

 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 28/88 (31%), Positives = 35/88 (39%), Gaps = 4/88 (4%)
 Frame = +2

Query: 248 PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC--WCCSNPASGSLHSPCS 421
           P C+  CC  +C    T CC   C  SCC  S   CC    C   CC +   G      +
Sbjct: 125 PCCHPTCCQNTCCR--TTCCQPTCVASCCQPS---CCSTPCCQPTCCGSSCCGQTSCGTT 179

Query: 422 CC--ICCRLPIWSSTSSTFPVWICTSVC 499
           CC   CC+ P     +S  P    +S C
Sbjct: 180 CCQPTCCQ-PTCCRNTSCQPTCCGSSCC 206



 Score = 41.1 bits (92), Expect = 0.022
 Identities = 29/91 (31%), Positives = 33/91 (36%)
 Frame = +2

Query: 227 RPSLLP*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSL 406
           +PS    P C   CC  SC      C    CGT+CC  +   CC      CC N +    
Sbjct: 152 QPSCCSTPCCQPTCCGSSC------CGQTSCGTTCCQPT---CCQPT---CCRNTSCQPT 199

Query: 407 HSPCSCCICCRLPIWSSTSSTFPVWICTSVC 499
               SCC  C  P    T       IC S C
Sbjct: 200 CCGSSCCQPCCHPTCCQT-------ICRSTC 223



 Score = 36.7 bits (81), Expect = 0.46
 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 3/43 (6%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTF--CCSNRCGTSCC-PSSGILCCFAILC 373
           C   CC  SC   C    CC   C ++CC PS    CC    C
Sbjct: 196 CQPTCCGSSCCQPCCHPTCCQTICRSTCCQPSCVTRCCSTPCC 238



 Score = 32.7 bits (71), Expect = 7.5
 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 5/53 (9%)
 Frame = +2

Query: 296 TFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPC---SCCI--CCR 439
           T CCS  C  +CC ++   CC    CW  +   + S  +PC   SCC+  CC+
Sbjct: 77  THCCSPCCQPTCCRTT---CC-RTTCWKPTTVTTCS-STPCCQPSCCVPSCCQ 124


>UniRef50_Q9BYR0 Cluster: Keratin-associated protein 4-7; n=149;
           Eukaryota|Rep: Keratin-associated protein 4-7 - Homo
           sapiens (Human)
          Length = 210

 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 28/84 (33%), Positives = 37/84 (44%), Gaps = 2/84 (2%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC--WCCSNPASGSLHSPCSCC 427
           C S+CC  +C  R + C S+ C  SCC SS   CC    C   CC  P  G +    SC 
Sbjct: 135 CQSVCCQPTCC-RPSCCISSCCRPSCCESS---CCRPCCCRPCCCLRPVCGRV----SCH 186

Query: 428 ICCRLPIWSSTSSTFPVWICTSVC 499
             C  P    ++   P+   +S C
Sbjct: 187 TTCYRPTCVISTCPRPLCCASSCC 210



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 33/90 (36%), Positives = 37/90 (41%), Gaps = 7/90 (7%)
 Frame = +2

Query: 251 LCNSICCSYSCTLRCTFCCSNRC-GTSCCPSSGIL--CCFAILCW--CC--SNPASGSLH 409
           LC   CC  SC    T CC   C   SCC SS     CC ++ C   CC  S   +   H
Sbjct: 19  LCQETCCRPSCCQ--TTCCRTTCYRPSCCVSSCCRPQCCQSVCCQPTCCRPSCCETTCCH 76

Query: 410 SPCSCCICCRLPIWSSTSSTFPVWICTSVC 499
             C    CCR P    +S   P   C SVC
Sbjct: 77  PRCCISSCCR-PSCCMSSCCKP-QCCQSVC 104



 Score = 41.9 bits (94), Expect = 0.012
 Identities = 28/70 (40%), Positives = 35/70 (50%), Gaps = 8/70 (11%)
 Frame = +2

Query: 254 CNSICCSYSCTL-RCTFCCSNRCGTSCCPSSGI--LCCFAILCW-CCSNPASGSLHSPC- 418
           C   CC  +C   RC  C S+ C  SCC SS     CC ++ C   C +P S  + S C 
Sbjct: 65  CRPSCCETTCCHPRC--CISSCCRPSCCMSSCCKPQCCQSVCCQPTCCHP-SCCISSCCR 121

Query: 419 -SCCI--CCR 439
            SCC+  CCR
Sbjct: 122 PSCCVSRCCR 131



 Score = 41.5 bits (93), Expect = 0.016
 Identities = 30/88 (34%), Positives = 37/88 (42%), Gaps = 6/88 (6%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGI--LCCFAILC--WCCSNPASGSLHSPCS 421
           C S+CC  +C  R + C +  C   CC SS     CC +  C   CC +          S
Sbjct: 55  CQSVCCQPTCC-RPSCCETTCCHPRCCISSCCRPSCCMSSCCKPQCCQSVCCQPTCCHPS 113

Query: 422 CCI--CCRLPIWSSTSSTFPVWICTSVC 499
           CCI  CCR P    +    P   C SVC
Sbjct: 114 CCISSCCR-PSCCVSRCCRP-QCCQSVC 139



 Score = 40.3 bits (90), Expect = 0.038
 Identities = 26/69 (37%), Positives = 33/69 (47%), Gaps = 7/69 (10%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGI--LCCFAILCW-CCSNPASGSLHSPC-- 418
           C S+CC  +C    + C S+ C  SCC S      CC ++ C   C  P S  + S C  
Sbjct: 100 CQSVCCQPTCC-HPSCCISSCCRPSCCVSRCCRPQCCQSVCCQPTCCRP-SCCISSCCRP 157

Query: 419 SCC--ICCR 439
           SCC   CCR
Sbjct: 158 SCCESSCCR 166



 Score = 38.3 bits (85), Expect = 0.15
 Identities = 23/66 (34%), Positives = 27/66 (40%), Gaps = 4/66 (6%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC--WCCSNPASGSLHSPCSCC 427
           C+  CC  SC  R + C S  C   CC S   +CC    C   CC +          SCC
Sbjct: 110 CHPSCCISSCC-RPSCCVSRCCRPQCCQS---VCCQPTCCRPSCCISSCCRPSCCESSCC 165

Query: 428 --ICCR 439
              CCR
Sbjct: 166 RPCCCR 171



 Score = 37.9 bits (84), Expect = 0.20
 Identities = 26/69 (37%), Positives = 31/69 (44%), Gaps = 6/69 (8%)
 Frame = +2

Query: 254 CNSICCSYSCTL-RCTF--CCSNRC-GTSCCPSSGILCCFAILCW--CCSNPASGSLHSP 415
           C S CC  SC + RC    CC + C   +CC  S   CC +  C   CC +    S   P
Sbjct: 115 CISSCCRPSCCVSRCCRPQCCQSVCCQPTCCRPS---CCISSCCRPSCCES----SCCRP 167

Query: 416 CSCCICCRL 442
           C C  CC L
Sbjct: 168 CCCRPCCCL 176


>UniRef50_UPI0001555AB0 Cluster: PREDICTED: hypothetical protein;
           n=4; Ornithorhynchus anatinus|Rep: PREDICTED:
           hypothetical protein - Ornithorhynchus anatinus
          Length = 288

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 26/76 (34%), Positives = 31/76 (40%), Gaps = 6/76 (7%)
 Frame = +2

Query: 230 PSLLP*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGI--LCCFAILC--WCCSNPAS 397
           PS    P C   CC  +C  R T C    C TSCC  +     CC ++ C   CC  P  
Sbjct: 27  PSCCSSPCCPPTCCQTTCC-RTTCCRPTCCVTSCCRPTCCRPTCCQSVCCQPTCCRPPCC 85

Query: 398 GSLHSPCSCC--ICCR 439
                  +CC   CCR
Sbjct: 86  RPTCCQTTCCRTTCCR 101



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 28/98 (28%), Positives = 39/98 (39%), Gaps = 4/98 (4%)
 Frame = +2

Query: 227 RPSLLP*PLCNSICCSYSC----TLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPA 394
           RP+      C S+CC  +C      R T C +  C T+CC  +   CC    C  C  PA
Sbjct: 61  RPTCCRPTCCQSVCCQPTCCRPPCCRPTCCQTTCCRTTCCRPT---CCVPTCCQPCCRPA 117

Query: 395 SGSLHSPCSCCICCRLPIWSSTSSTFPVWICTSVCSID 508
                + C    CCR    +S+ S   +    S  + D
Sbjct: 118 --CCQTTCCRTTCCRPTCGASSYSLAEIATFCSTSAFD 153



 Score = 38.7 bits (86), Expect = 0.11
 Identities = 24/61 (39%), Positives = 26/61 (42%), Gaps = 3/61 (4%)
 Frame = +2

Query: 221 QHRPSLLP*PLCNSICCSYSCTLRCTFCCSNRC--GTSCCPSSGILCCFAILC-WCCSNP 391
           Q +    P P C S CC   C  R T CC + C   TSC PS    CC    C   C  P
Sbjct: 173 QSKKPCCPPPCCGSTCCQPCC--RPT-CCLSSCYPPTSCVPSCCQPCCLPTCCQTTCCKP 229

Query: 392 A 394
           A
Sbjct: 230 A 230


>UniRef50_Q4UB39 Cluster: Putative uncharacterized protein; n=5;
            Theileria|Rep: Putative uncharacterized protein -
            Theileria annulata
          Length = 2424

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 31/79 (39%), Positives = 37/79 (46%), Gaps = 15/79 (18%)
 Frame = +2

Query: 254  CNSICCSYSCTLRCTFCCS--NRCGTS---C-CPSSG--ILCCF----AILCWCCSNPAS 397
            C+  CC+    + CT CC+  N+CGT    C CP S     CC     A    CCS   +
Sbjct: 1400 CDKTCCADDKKISCT-CCNHTNKCGTKVQCCSCPKSNGECKCCCKQNGACQQSCCSKATN 1458

Query: 398  GSLHSPC--SCCIC-CRLP 445
            GS    C   CCIC CR P
Sbjct: 1459 GSTSCVCCRCCCICFCRCP 1477


>UniRef50_UPI000155BC4F Cluster: PREDICTED: hypothetical protein,
           partial; n=1; Ornithorhynchus anatinus|Rep: PREDICTED:
           hypothetical protein, partial - Ornithorhynchus anatinus
          Length = 309

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 32/96 (33%), Positives = 36/96 (37%), Gaps = 5/96 (5%)
 Frame = +2

Query: 227 RPSLLP*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCW--CCSNPASG 400
           +P     P C   CC  +C  R T C    C TSCC  +   CC    C   CC      
Sbjct: 26  QPGCCSSPCCPPTCCQTTCC-RTTCCRPTCCVTSCCRPT---CCRPTCCQSVCCQPMCCR 81

Query: 401 SLHSPCSCC-ICCRLPIWSST--SSTFPVWICTSVC 499
            + S  SCC  CC  P   ST      P   C S C
Sbjct: 82  PVCSVASCCRPCCPQPCCVSTCCRPCCPRPCCVSSC 117



 Score = 44.4 bits (100), Expect = 0.002
 Identities = 24/68 (35%), Positives = 26/68 (38%), Gaps = 2/68 (2%)
 Frame = +2

Query: 242 P*PLCNSICCSYSCTLRC--TFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSP 415
           P P C S CC   C   C    CC + C   CCP     CC    C  C  PA     + 
Sbjct: 109 PRPCCVSSCCRPCCPRPCCPQPCCVSTCCRPCCPRP---CCVPSCCQPCCRPA--CCQTT 163

Query: 416 CSCCICCR 439
           C    CCR
Sbjct: 164 CCRTTCCR 171



 Score = 41.5 bits (93), Expect = 0.016
 Identities = 26/75 (34%), Positives = 30/75 (40%), Gaps = 11/75 (14%)
 Frame = +2

Query: 248 PLCNSICCSYSCTLRCTF--CCSNRCGTSCCPSSGI--LCCFAILCW-CCSNPAS-GSLH 409
           P C   CC  +C   C    CC + C   CCP       CC +  C  CC  P    S  
Sbjct: 92  PCCPQPCCVSTCCRPCCPRPCCVSSCCRPCCPRPCCPQPCCVSTCCRPCCPRPCCVPSCC 151

Query: 410 SPC---SCC--ICCR 439
            PC   +CC   CCR
Sbjct: 152 QPCCRPACCQTTCCR 166



 Score = 40.7 bits (91), Expect = 0.028
 Identities = 28/89 (31%), Positives = 34/89 (38%), Gaps = 5/89 (5%)
 Frame = +2

Query: 254 CNSICCSYSCTLRC---TFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSC 424
           C S+C   SC   C   T C    C + CCP +   CC      CC            SC
Sbjct: 6   CGSVCSDLSCGRGCCQETCCQPGCCSSPCCPPT---CCQTT---CCRTTCCRPTCCVTSC 59

Query: 425 C--ICCRLPIWSSTSSTFPVWICTSVCSI 505
           C   CCR P    +    P+  C  VCS+
Sbjct: 60  CRPTCCR-PTCCQSVCCQPM-CCRPVCSV 86



 Score = 40.3 bits (90), Expect = 0.038
 Identities = 25/80 (31%), Positives = 28/80 (35%), Gaps = 5/80 (6%)
 Frame = +2

Query: 242 P*PLCNSICCSYSCTLRCTF--CCSNRCGTSCCPSSGILCCFAILC--WCCSNPASGSLH 409
           P P C S CC   C   C    CC   C  +CC ++   CC    C   CC         
Sbjct: 128 PQPCCVSTCCRPCCPRPCCVPSCCQPCCRPACCQTT---CCRTTCCRPTCCVPTCCQPCC 184

Query: 410 SPCSC-CICCRLPIWSSTSS 466
            P  C   CCR      T S
Sbjct: 185 RPACCQTTCCRTTCCRPTCS 204



 Score = 34.3 bits (75), Expect = 2.5
 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 6/46 (13%)
 Frame = +2

Query: 254 CNSICCSYSCT----LRCTFCCSNRCGTSCC-PS-SGILCCFAILC 373
           CNS CC  +C+     R T C +  C TSCC P+     CC ++ C
Sbjct: 257 CNSPCCPPTCSQTTCYRTTCCQATCCVTSCCRPTCCSPYCCQSVCC 302


>UniRef50_UPI0000D8A05A Cluster: aaa family atpase; n=1; Eimeria
           tenella|Rep: aaa family atpase - Eimeria tenella
          Length = 1294

 Score = 44.0 bits (99), Expect = 0.003
 Identities = 20/59 (33%), Positives = 27/59 (45%), Gaps = 2/59 (3%)
 Frame = +2

Query: 251 LCNSICCSYSCTLRCTFCCSNRCGTSCCPSSG--ILCCFAILCWCCSNPASGSLHSPCS 421
           +C   CCS+ C   C  CC  R    CC      + CC +   +CC +PA  S  +P S
Sbjct: 433 VCRCRCCSFCC---CCCCCCRRWEFCCCCCCRYHLRCCCSCCSFCCCSPARASATTPAS 488



 Score = 36.3 bits (80), Expect = 0.61
 Identities = 21/65 (32%), Positives = 25/65 (38%), Gaps = 3/65 (4%)
 Frame = +2

Query: 281 CTLRCTFCCSNRCGTSCCPSSGILCCFAILCW--CCSNPASGSLHSPCSCC-ICCRLPIW 451
           C   C   C  RC + CC      CC     W  CC       L   CSCC  CC  P  
Sbjct: 426 CQADCVGVCRCRCCSFCC-----CCCCCCRRWEFCCCCCCRYHLRCCCSCCSFCCCSPAR 480

Query: 452 SSTSS 466
           +S ++
Sbjct: 481 ASATT 485



 Score = 32.3 bits (70), Expect = 10.0
 Identities = 17/53 (32%), Positives = 23/53 (43%), Gaps = 2/53 (3%)
 Frame = +2

Query: 221  QHRPSLLP*PLCNSICCSYSCTLRCT-FCCSNRC-GTSCCPSSGILCCFAILC 373
            Q +  LL  P+C+  CC   C   C+  CC   C GT    +S +    A  C
Sbjct: 1234 QQQQQLLREPICSLCCCCCCCCCCCSVLCCCCACGGTQTLTASRVSIHLAAAC 1286


>UniRef50_Q0J1G4 Cluster: Os09g0441900 protein; n=2; Oryza sativa
           (japonica cultivar-group)|Rep: Os09g0441900 protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 444

 Score = 43.6 bits (98), Expect = 0.004
 Identities = 24/81 (29%), Positives = 33/81 (40%), Gaps = 3/81 (3%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSC--C 427
           C+S C    C   C+ CC+     SCC      CC    C CC  P+    +  CSC  C
Sbjct: 141 CSSCCDEPCCKPNCSACCAG----SCCSPDCCSCCKPN-CSCCKTPSCCKPNCSCSCPSC 195

Query: 428 -ICCRLPIWSSTSSTFPVWIC 487
             CC       + + F ++ C
Sbjct: 196 SSCCDTSCCKPSCTCFNIFSC 216



 Score = 42.3 bits (95), Expect = 0.009
 Identities = 23/63 (36%), Positives = 26/63 (41%), Gaps = 2/63 (3%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHS--PCSCC 427
           C+   C   C    T CCS  C  SC    G  CC    C+ CS P   S  +   CSC 
Sbjct: 297 CSCAQCKPDCGSCSTNCCS--CKPSCNGCCGEQCCRCADCFSCSCPRCSSCFNIFKCSCA 354

Query: 428 ICC 436
            CC
Sbjct: 355 GCC 357



 Score = 41.9 bits (94), Expect = 0.012
 Identities = 27/84 (32%), Positives = 30/84 (35%), Gaps = 4/84 (4%)
 Frame = +2

Query: 248 PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSC- 424
           P C    CS SC   C+ CC   C    C    I  CF  L  C   P+     S C+C 
Sbjct: 181 PSCCKPNCSCSCP-SCSSCCDTSCCKPSCTCFNIFSCFKSLYSCFKIPS--CFKSQCNCS 237

Query: 425 ---CICCRLPIWSSTSSTFPVWIC 487
              C  C LP  S      P   C
Sbjct: 238 SPNCCTCTLPSCSCKGCACPSCGC 261



 Score = 37.5 bits (83), Expect = 0.26
 Identities = 29/100 (29%), Positives = 38/100 (38%), Gaps = 7/100 (7%)
 Frame = +2

Query: 221 QHRPSLLP*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCW-CCSNPAS 397
           +HR   L   + + +C   SC   C  C        C   S   CC    C   CS   +
Sbjct: 100 RHRSCRLFRWIGSKLCICISCLCYCCKCSPKCKRPRCLNCSCSSCCDEPCCKPNCSACCA 159

Query: 398 GSLHSP--CSC----CICCRLPIWSSTSSTFPVWICTSVC 499
           GS  SP  CSC    C CC+ P     + +     C+S C
Sbjct: 160 GSCCSPDCCSCCKPNCSCCKTPSCCKPNCSCSCPSCSSCC 199



 Score = 36.3 bits (80), Expect = 0.61
 Identities = 21/64 (32%), Positives = 25/64 (39%), Gaps = 2/64 (3%)
 Frame = +2

Query: 254 CNSIC--CSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           C + C  C  SC  R   CC  +C +SCC      CC      CCS P        C C 
Sbjct: 365 CTTQCFSCQSSCCKRQPSCC--KCQSSCCEGQPS-CCEG---HCCSLPKPSCPECSCGCV 418

Query: 428 ICCR 439
             C+
Sbjct: 419 WSCK 422



 Score = 35.9 bits (79), Expect = 0.81
 Identities = 25/75 (33%), Positives = 29/75 (38%), Gaps = 2/75 (2%)
 Frame = +2

Query: 248 PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPC-SC 424
           P C S  CS +C   C   C+  CG  CC  +    C    C  C N    S    C S 
Sbjct: 304 PDCGS--CSTNCC-SCKPSCNGCCGEQCCRCADCFSCSCPRCSSCFNIFKCSCAGCCSSL 360

Query: 425 CIC-CRLPIWSSTSS 466
           C C C    +S  SS
Sbjct: 361 CKCPCTTQCFSCQSS 375



 Score = 35.5 bits (78), Expect = 1.1
 Identities = 20/63 (31%), Positives = 27/63 (42%), Gaps = 4/63 (6%)
 Frame = +2

Query: 248 PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCC---FAILCWCCSNPASGSLHSP- 415
           P C++ C    C+  C  CC   C  SCC +    CC    +  C  CS+    S   P 
Sbjct: 152 PNCSACCAGSCCSPDCCSCCKPNC--SCCKTPS--CCKPNCSCSCPSCSSCCDTSCCKPS 207

Query: 416 CSC 424
           C+C
Sbjct: 208 CTC 210



 Score = 32.7 bits (71), Expect = 7.5
 Identities = 20/59 (33%), Positives = 24/59 (40%), Gaps = 3/59 (5%)
 Frame = +2

Query: 266 CCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWC--CSNPASG-SLHSPCSCCIC 433
           C   SC+ +   C S  C    CPS G   C    C C  C  P+ G +    CSC  C
Sbjct: 244 CTLPSCSCKGCACPSCGCNGCGCPSCGCNGCGCPSCGCNGCGLPSCGCNGCGSCSCAQC 302


>UniRef50_P60412 Cluster: Keratin-associated protein 10-11; n=80;
           Eutheria|Rep: Keratin-associated protein 10-11 - Homo
           sapiens (Human)
          Length = 298

 Score = 43.2 bits (97), Expect = 0.005
 Identities = 26/87 (29%), Positives = 34/87 (39%), Gaps = 5/87 (5%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCC-SNRCGTSCCPSSGI--LCCFAILC--WCCSNPASGSLHSPC 418
           C  +CC   C    + CC  + C  +CC SS     CC  + C   CC +  S       
Sbjct: 110 CKPVCCVPVCCGAASSCCRQSSCQPACCASSSCQPACCVPVCCKPVCCVSTCS---EDSS 166

Query: 419 SCCICCRLPIWSSTSSTFPVWICTSVC 499
           SCC          TSS++    C  VC
Sbjct: 167 SCCQQSSCQPACCTSSSYQQACCVPVC 193



 Score = 42.3 bits (95), Expect = 0.009
 Identities = 31/103 (30%), Positives = 45/103 (43%), Gaps = 19/103 (18%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCC-SNRCGTSCCPSSGI-------LCCFAILC--WCCSNPASGS 403
           C  +CC  +C+   + CC  + C  +CC SS         +CC  + C   CC    S +
Sbjct: 152 CKPVCCVSTCSEDSSSCCQQSSCQPACCTSSSYQQACCVPVCCKTVYCKPICCVPVCSRA 211

Query: 404 LHSPC-------SCCI--CCRLPIWSSTSSTFPVWICTSVCSI 505
            +S C       +CC   CCR P  SS+ S     +C S C +
Sbjct: 212 SYSRCQQPSCQPACCTTSCCR-P--SSSVSLLCHPVCRSTCCV 251



 Score = 36.7 bits (81), Expect = 0.46
 Identities = 23/73 (31%), Positives = 26/73 (35%), Gaps = 2/73 (2%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCW--CCSNPASGSLHSPCSCC 427
           C   CC   C    T CC   C    C  +   CC    C   CC   AS S    C   
Sbjct: 95  CQQACCVPVCCK--TVCCKPVCCVPVCCGAASSCCRQSSCQPACC---ASSSCQPACCVP 149

Query: 428 ICCRLPIWSSTSS 466
           +CC+     ST S
Sbjct: 150 VCCKPVCCVSTCS 162



 Score = 36.3 bits (80), Expect = 0.61
 Identities = 26/86 (30%), Positives = 32/86 (37%)
 Frame = +2

Query: 242 P*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCS 421
           P P  + +C   SC    + CC   C  S C S     C    C   S   +    SPC 
Sbjct: 39  PAPSLSLVCTPVSCV--SSPCCQAACEPSACQSGCTSSCTPSCCQQSSCQPACCTSSPCQ 96

Query: 422 CCICCRLPIWSSTSSTFPVWICTSVC 499
              CC +P+   T    PV  C  VC
Sbjct: 97  QA-CC-VPVCCKTVCCKPV-CCVPVC 119



 Score = 33.1 bits (72), Expect = 5.7
 Identities = 26/70 (37%), Positives = 38/70 (54%), Gaps = 5/70 (7%)
 Frame = +2

Query: 227 RPSLLP*PLCNSICCSYSCTLRCTFCC--SNRCGTS-CCPSSGILCCFAILCWCCSNPAS 397
           RPS     LC+ +C S +C +  + CC  ++ C +S CCP+S    C ++LC     PAS
Sbjct: 232 RPSSSVSLLCHPVCRS-TCCVPVSSCCAPTSSCQSSCCCPAS----CVSLLC----RPAS 282

Query: 398 GSL--HSPCS 421
             L  +S CS
Sbjct: 283 SRLACYSLCS 292



 Score = 32.3 bits (70), Expect = 10.0
 Identities = 27/85 (31%), Positives = 33/85 (38%)
 Frame = +2

Query: 248 PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           P C   CC+ SC   C    S+     C P     CC  +   CC+ P S S  S C C 
Sbjct: 219 PSCQPACCTTSC---CR--PSSSVSLLCHPVCRSTCCVPVSS-CCA-PTS-SCQSSCCCP 270

Query: 428 ICCRLPIWSSTSSTFPVWICTSVCS 502
             C   +    SS      C S+CS
Sbjct: 271 ASCVSLLCRPASSRL---ACYSLCS 292


>UniRef50_UPI0000EBDE4C Cluster: PREDICTED: similar to keratin
           associated protein 9.2; n=1; Bos taurus|Rep: PREDICTED:
           similar to keratin associated protein 9.2 - Bos taurus
          Length = 230

 Score = 42.7 bits (96), Expect = 0.007
 Identities = 27/92 (29%), Positives = 36/92 (39%), Gaps = 10/92 (10%)
 Frame = +2

Query: 254 CNSICCSYSCTLRC-----TFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPC 418
           C S CC  SC   C     T CC   C TSCC  S           CC + ++G      
Sbjct: 47  CESSCCQPSCPQTCCQITETTCCKPTCVTSCCQPS-----------CCGSISAGQTCGGS 95

Query: 419 SCC-ICCR----LPIWSSTSSTFPVWICTSVC 499
           +CC  CC+     P++   +   P  +C   C
Sbjct: 96  NCCQPCCQPASCAPVYCHRTCYHPTCLCLPGC 127



 Score = 36.7 bits (81), Expect = 0.46
 Identities = 24/70 (34%), Positives = 27/70 (38%), Gaps = 12/70 (17%)
 Frame = +2

Query: 254 CNSICCSYSCTLRC----------TFCCSNRC-GTSCC-PSSGILCCFAILCWCCSNPAS 397
           C + CC  +CT  C          T CC   C  +SCC PS    CC      CC     
Sbjct: 15  CRTTCCKPTCTTCCRTTCLKPICVTTCCQPTCCESSCCQPSCPQTCCQITETTCCKPTCV 74

Query: 398 GSLHSPCSCC 427
            S   P SCC
Sbjct: 75  TSCCQP-SCC 83



 Score = 35.1 bits (77), Expect = 1.4
 Identities = 27/87 (31%), Positives = 34/87 (39%), Gaps = 6/87 (6%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCC-PSSGILCCFAILC--WCCSNPASGSLHSP-CS 421
           C+  C   +C L    C    CG+SCC P S  +CC    C   CC      +   P CS
Sbjct: 112 CHRTCYHPTC-LCLPGCQDQSCGSSCCQPCSRPVCCQTTCCRTTCCKPTCVTTCCQPTCS 170

Query: 422 CC--ICCRLPIWSSTSSTFPVWICTSV 496
                   L   S  +S  PV  CT +
Sbjct: 171 AVDKTVVGLTAVSLAASQLPVHPCTDI 197


>UniRef50_A2A4R5 Cluster: Novel member of the keratin associated
           protein 4 (Krtap4) family; n=10; Theria|Rep: Novel
           member of the keratin associated protein 4 (Krtap4)
           family - Mus musculus (Mouse)
          Length = 167

 Score = 42.7 bits (96), Expect = 0.007
 Identities = 27/83 (32%), Positives = 33/83 (39%), Gaps = 9/83 (10%)
 Frame = +2

Query: 227 RPSLLP*PLCNSICCSYSCTL-RCTF--CC------SNRCGTSCCPSSGILCCFAILCWC 379
           RPS      C S+CC  +C    C    CC      S+ CG+SCC      CC +  C  
Sbjct: 55  RPSCCRPQCCQSVCCQPTCCRPSCCISSCCQPSCGSSSCCGSSCCRPCCRPCC-SPCCSP 113

Query: 380 CSNPASGSLHSPCSCCICCRLPI 448
           C  P       PC    CC  P+
Sbjct: 114 CCRPCCRPCCRPCCRPCCCLRPV 136



 Score = 41.9 bits (94), Expect = 0.012
 Identities = 26/73 (35%), Positives = 33/73 (45%), Gaps = 4/73 (5%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC--WCCSNPASGSLHSPCSCC 427
           C + CC  +C  R + C S+ C  SCC SS   CC    C   CC +          SCC
Sbjct: 24  CQTTCCRTTCC-RPSCCVSSCCRPSCCVSS---CCRPSCCRPQCCQSVCCQPTCCRPSCC 79

Query: 428 I--CCRLPIWSST 460
           I  CC+    SS+
Sbjct: 80  ISSCCQPSCGSSS 92



 Score = 37.9 bits (84), Expect = 0.20
 Identities = 28/75 (37%), Positives = 32/75 (42%), Gaps = 4/75 (5%)
 Frame = +2

Query: 227 RPSLLP*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC-WCCSNPASGS 403
           RPS      C   CC  SC  R + C    C + CC  +   CC    C   C  P+ GS
Sbjct: 35  RPSCCVSSCCRPSCCVSSCC-RPSCCRPQCCQSVCCQPT---CCRPSCCISSCCQPSCGS 90

Query: 404 LHSPC--SCC-ICCR 439
             S C  SCC  CCR
Sbjct: 91  -SSCCGSSCCRPCCR 104



 Score = 36.7 bits (81), Expect = 0.46
 Identities = 23/67 (34%), Positives = 28/67 (41%), Gaps = 6/67 (8%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGI--LCCFAILC--WCCSNPASGSLHSPCS 421
           C   CC  SC  + T C +  C  SCC SS     CC +  C   CC      S+    +
Sbjct: 14  CGQGCCQPSCC-QTTCCRTTCCRPSCCVSSCCRPSCCVSSCCRPSCCRPQCCQSVCCQPT 72

Query: 422 CC--ICC 436
           CC   CC
Sbjct: 73  CCRPSCC 79



 Score = 36.3 bits (80), Expect = 0.61
 Identities = 20/61 (32%), Positives = 23/61 (37%), Gaps = 2/61 (3%)
 Frame = +2

Query: 248 PLC-NSICCSYSCTLRCTF-CCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCS 421
           P C +S CC  SC   C   CCS  C   C P     C       CC  P  G +    +
Sbjct: 86  PSCGSSSCCGSSCCRPCCRPCCSPCCSPCCRPCCRPCCRPCCRPCCCLRPVCGQVCCQTT 145

Query: 422 C 424
           C
Sbjct: 146 C 146


>UniRef50_UPI000155F1D8 Cluster: PREDICTED: hypothetical protein;
           n=1; Equus caballus|Rep: PREDICTED: hypothetical protein
           - Equus caballus
          Length = 184

 Score = 41.9 bits (94), Expect = 0.012
 Identities = 31/94 (32%), Positives = 37/94 (39%), Gaps = 8/94 (8%)
 Frame = +2

Query: 248 PLCNSICCSYSCTLR---CTFCCSNRCG-TSCCPS--SGILCCFAILCWCCSNPASGSLH 409
           P C S CC  SC +    C FC S+ C   SCC +      CC   L  CC     G+  
Sbjct: 82  PRCMSSCCHSSCCISGCCCPFCYSSSCSHPSCCVTGCGQETCC---LPSCCQTSCCGTTC 138

Query: 410 SPCSCCI--CCRLPIWSSTSSTFPVWICTSVCSI 505
              SCC+  CC        +   P   C S C I
Sbjct: 139 CRPSCCMSSCCH------PNCCVPNCCCPSYCQI 166



 Score = 40.3 bits (90), Expect = 0.038
 Identities = 26/86 (30%), Positives = 33/86 (38%), Gaps = 4/86 (4%)
 Frame = +2

Query: 254 CNSICCSYSCT---LRCTFCCSNRCGTSCCPSSGILCCFAILCWC-CSNPASGSLHSPCS 421
           C S+     C     + T CC   C T+CC  S   C    +  C C    S   HS C 
Sbjct: 35  CGSVFSEQGCAGGLCQETCCCPTCCRTTCCRVSSCCCPRCCVSSCHCPRCMSSCCHSSCC 94

Query: 422 CCICCRLPIWSSTSSTFPVWICTSVC 499
              CC  P   S+S + P   C + C
Sbjct: 95  ISGCC-CPFCYSSSCSHPS-CCVTGC 118



 Score = 39.9 bits (89), Expect = 0.050
 Identities = 25/69 (36%), Positives = 30/69 (43%), Gaps = 9/69 (13%)
 Frame = +2

Query: 251 LCNSICCSYSC--TLRC---TFCCSNRCGTSC-CPSSGILCCFAILC---WCCSNPASGS 403
           LC   CC  +C  T  C   + CC   C +SC CP     CC +  C    CC    S S
Sbjct: 48  LCQETCCCPTCCRTTCCRVSSCCCPRCCVSSCHCPRCMSSCCHSSCCISGCCCPFCYSSS 107

Query: 404 LHSPCSCCI 430
              P SCC+
Sbjct: 108 CSHP-SCCV 115


>UniRef50_Q14C04 Cluster: Keratin associated protein 4-7; n=17;
           Mammalia|Rep: Keratin associated protein 4-7 - Mus
           musculus (Mouse)
          Length = 168

 Score = 41.9 bits (94), Expect = 0.012
 Identities = 32/93 (34%), Positives = 33/93 (35%), Gaps = 2/93 (2%)
 Frame = +2

Query: 227 RPSLLP*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC--WCCSNPASG 400
           RPS      C   CC  SC  R   C S  C  +CC  S   CC    C   CC     G
Sbjct: 56  RPSCCRPSCCRPSCCVSSCC-RPQCCQSVCCQPTCCRPS---CCRPSCCISSCCQPSCGG 111

Query: 401 SLHSPCSCCICCRLPIWSSTSSTFPVWICTSVC 499
           S     SCC  C  P         PV  C  VC
Sbjct: 112 SSCCGSSCCRPCCRPCCRPCCCLRPV--CGQVC 142



 Score = 41.5 bits (93), Expect = 0.016
 Identities = 24/66 (36%), Positives = 30/66 (45%), Gaps = 4/66 (6%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC--WCCSNPASGSLHSPCSCC 427
           C S+CC  +C  R + C S+ C  SCC  S   CC    C   CC      S+    +CC
Sbjct: 35  CQSVCCQPTCC-RPSCCISSCCRPSCCRPS---CCRPSCCVSSCCRPQCCQSVCCQPTCC 90

Query: 428 --ICCR 439
              CCR
Sbjct: 91  RPSCCR 96



 Score = 36.3 bits (80), Expect = 0.61
 Identities = 24/66 (36%), Positives = 27/66 (40%), Gaps = 4/66 (6%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCW--CCSNPASGSLHSPCSCC 427
           C   CC  SC  R + C  + C  SCC SS   CC    C   CC            SCC
Sbjct: 45  CRPSCCISSCC-RPSCCRPSCCRPSCCVSS---CCRPQCCQSVCCQPTCCRPSCCRPSCC 100

Query: 428 I--CCR 439
           I  CC+
Sbjct: 101 ISSCCQ 106


>UniRef50_A7TG94 Cluster: Putative metallothionein; n=2;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           metallothionein - Vanderwaltozyma polyspora DSM 70294
          Length = 176

 Score = 41.9 bits (94), Expect = 0.012
 Identities = 30/94 (31%), Positives = 38/94 (40%), Gaps = 5/94 (5%)
 Frame = +2

Query: 302 CCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC----ICCRLPIWSSTSST 469
           C  N+     C      CC    C CC    S S    CSC     ICCR  I      T
Sbjct: 51  CIGNKKVDCSCEQKERGCCKKQKCSCCEKVCSCSCSCSCSCSGKPKICCRTNI---PKCT 107

Query: 470 FPVWICTSVCSIDEKE-HKAFLQRLKTKDLLVDK 568
             + ICTS CS   K  HK+  +   +K++ + K
Sbjct: 108 CGIEICTSQCSCTIKSCHKSQEKPCDSKNICICK 141


>UniRef50_UPI000021D9F7 Cluster: PREDICTED: similar to keratin
           associated protein 10-7; n=7; Rattus norvegicus|Rep:
           PREDICTED: similar to keratin associated protein 10-7 -
           Rattus norvegicus
          Length = 230

 Score = 41.5 bits (93), Expect = 0.016
 Identities = 31/97 (31%), Positives = 37/97 (38%), Gaps = 7/97 (7%)
 Frame = +2

Query: 230 PSLLP*PLCNSICCSYSCT--LRCTFCCSNRCGTS-CCPSSGIL--CCFAILCW--CCSN 388
           PS      C S CC+ SC+    C  C    C +S CC SS     CC    C   CC+ 
Sbjct: 49  PSCCVPSCCQSSCCAPSCSAPTPCLLCTPVSCVSSPCCQSSCCTPSCCQQSSCQPACCT- 107

Query: 389 PASGSLHSPCSCCICCRLPIWSSTSSTFPVWICTSVC 499
                   PC   +CC+       S   PV  C  VC
Sbjct: 108 --CSPCQQPCGVTLCCKPVCCVPPSCCVPV-CCRPVC 141



 Score = 38.7 bits (86), Expect = 0.11
 Identities = 27/82 (32%), Positives = 32/82 (39%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCIC 433
           C   CC+  C   C  C  + C +SCC  S   C     C  C+ P S  + SPC    C
Sbjct: 38  CQPSCCAPCCAPSC--CVPSCCQSSCCAPS---CSAPTPCLLCT-PVS-CVSSPCCQSSC 90

Query: 434 CRLPIWSSTSSTFPVWICTSVC 499
           C  P     SS  P     S C
Sbjct: 91  C-TPSCCQQSSCQPACCTCSPC 111



 Score = 35.1 bits (77), Expect = 1.4
 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 2/58 (3%)
 Frame = +2

Query: 251 LCNSICCSYSCTLRCTFCCSNRCGTSCC-PSSGILCCFAILCW-CCSNPASGSLHSPC 418
           LC+ +C   +C +  + CC++ C  +CC P+S    C ++LC   CS  A     S C
Sbjct: 178 LCSPVCRP-ACCVPTSSCCASSCQPNCCRPAS----CVSLLCRPACSRQACSGHKSTC 230



 Score = 34.3 bits (75), Expect = 2.5
 Identities = 23/78 (29%), Positives = 32/78 (41%), Gaps = 1/78 (1%)
 Frame = +2

Query: 269 CSYSCTLRCTFCCSNRCGTSCC-PSSGILCCFAILCWCCSNPASGSLHSPCSCCICCRLP 445
           C  SC   C+ C  + C  SCC P     CC  +   C S+  + S  +P  C +C   P
Sbjct: 23  CPESCCEPCS-CAPSCCQPSCCAPCCAPSCC--VPSCCQSSCCAPSCSAPTPCLLC--TP 77

Query: 446 IWSSTSSTFPVWICTSVC 499
           +   +S       CT  C
Sbjct: 78  VSCVSSPCCQSSCCTPSC 95



 Score = 33.5 bits (73), Expect = 4.3
 Identities = 28/81 (34%), Positives = 33/81 (40%), Gaps = 9/81 (11%)
 Frame = +2

Query: 254 CNSICC-SYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC---WC---CSNPASGSLHS 412
           C  +CC   SC +    CC   C T  C SS   CC    C    C   C  P S SL  
Sbjct: 121 CKPVCCVPPSCCV--PVCCRPVCYTPICSSSSSSCCQPSCCAPVCCKPVCCKPCS-SLSL 177

Query: 413 PCS--CCICCRLPIWSSTSST 469
            CS  C   C +P  S  +S+
Sbjct: 178 LCSPVCRPACCVPTSSCCASS 198


>UniRef50_P60372 Cluster: Keratin-associated protein 10-4; n=18;
           Eutheria|Rep: Keratin-associated protein 10-4 - Homo
           sapiens (Human)
          Length = 401

 Score = 41.5 bits (93), Expect = 0.016
 Identities = 27/89 (30%), Positives = 35/89 (39%), Gaps = 7/89 (7%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCC-SNRCGTSCCPSSGI--LCCFAILC--WCCSNPASGSLHSPC 418
           C ++CC   C+   + CC  + C  +CC SS     CC  + C   CC    S  + S  
Sbjct: 234 CKTVCCKPVCSEDSSSCCQQSSCQPACCTSSPCQQACCVPVCCKPVCCKPVGSVPICSGA 293

Query: 419 S--CCICCRLPIWSSTSSTFPVWICTSVC 499
           S  CC          TSS      C  VC
Sbjct: 294 SSLCCQQSSCQPACCTSSQSQQGCCVPVC 322



 Score = 41.1 bits (92), Expect = 0.022
 Identities = 25/89 (28%), Positives = 35/89 (39%), Gaps = 7/89 (7%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGI--LCCFAILC--WCCSNPASGSLHSPCS 421
           C  +CC   C    + C  + C ++CC SS     CC  I C   C    +S    S C 
Sbjct: 120 CKPVCCVPVCCGDSSCCQQSSCQSACCTSSPCQQACCVPICCKPVCSGISSSCCQQSSCV 179

Query: 422 CCI---CCRLPIWSSTSSTFPVWICTSVC 499
            C+   CC+     S   +  +  CT  C
Sbjct: 180 SCVSSPCCQAVCEPSPCQSGCISSCTPSC 208



 Score = 38.7 bits (86), Expect = 0.11
 Identities = 29/90 (32%), Positives = 34/90 (37%), Gaps = 11/90 (12%)
 Frame = +2

Query: 230 PSLLP*PLCNSICC-SYSCTLRCTF--CCSNRCGTSCCPSSGILCCFAILCW--CC-SNP 391
           PS      C   CC S SC   C    CC   C    C      CC    C   CC S+P
Sbjct: 206 PSCCQQSSCQPACCTSSSCQQACCVPVCCKTVCCKPVCSEDSSSCCQQSSCQPACCTSSP 265

Query: 392 ASGSLHSPCSC-CICCR----LPIWSSTSS 466
              +   P  C  +CC+    +PI S  SS
Sbjct: 266 CQQACCVPVCCKPVCCKPVGSVPICSGASS 295



 Score = 32.3 bits (70), Expect = 10.0
 Identities = 21/78 (26%), Positives = 29/78 (37%), Gaps = 6/78 (7%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCW--CCSNPASGSLHSPCSCC 427
           C   CC   C      CC        C  +  LCC    C   CC++  S      C   
Sbjct: 266 CQQACCVPVCCK--PVCCKPVGSVPICSGASSLCCQQSSCQPACCTSSQS---QQGCCVP 320

Query: 428 ICCR----LPIWSSTSST 469
           +CC+    +P+ S  SS+
Sbjct: 321 VCCKPVSCVPVCSGASSS 338


>UniRef50_UPI0000EBE77C Cluster: PREDICTED: hypothetical protein;
           n=7; Theria|Rep: PREDICTED: hypothetical protein - Bos
           taurus
          Length = 372

 Score = 41.1 bits (92), Expect = 0.022
 Identities = 25/84 (29%), Positives = 29/84 (34%), Gaps = 2/84 (2%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAIL--CWCCSNPASGSLHSPCSCC 427
           C S CC   C  +   CC   C  S C   G   C      C  C     G     CS  
Sbjct: 229 CGSSCCVPVCCCKPVCCCVPACSCSSCGKGGCGSCGGSKGGCGSCGGSKGGCGSCGCSQS 288

Query: 428 ICCRLPIWSSTSSTFPVWICTSVC 499
            CC+ P  S +S   P    +S C
Sbjct: 289 SCCK-PCCSQSSCCKPCCSQSSCC 311



 Score = 41.1 bits (92), Expect = 0.022
 Identities = 29/87 (33%), Positives = 34/87 (39%), Gaps = 1/87 (1%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCS-NRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCI 430
           C   CCS S    C  CCS + C   CC  S   CC  +   CCS     S   PC    
Sbjct: 290 CCKPCCSQSSC--CKPCCSQSSCCKPCCSQSS--CCIPV---CCSQ---SSCCKPCCSQS 339

Query: 431 CCRLPIWSSTSSTFPVWICTSVCSIDE 511
            C +P+  S SS        S C + E
Sbjct: 340 SCCIPVCCSQSSCCKPCCSQSSCCVPE 366



 Score = 36.3 bits (80), Expect = 0.61
 Identities = 24/71 (33%), Positives = 28/71 (39%), Gaps = 6/71 (8%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPC----S 421
           C   CCS S       C  + C   CC  S   CC  +   CCS     S   PC    S
Sbjct: 310 CCKPCCSQSSCCIPVCCSQSSCCKPCCSQSS--CCIPV---CCS---QSSCCKPCCSQSS 361

Query: 422 CCI--CCRLPI 448
           CC+  CC+  I
Sbjct: 362 CCVPECCQRKI 372


>UniRef50_Q5PAM7 Cluster: Putative uncharacterized protein; n=4;
           Anaplasma marginale str. St. Maries|Rep: Putative
           uncharacterized protein - Anaplasma marginale (strain
           St. Maries)
          Length = 532

 Score = 41.1 bits (92), Expect = 0.022
 Identities = 20/79 (25%), Positives = 37/79 (46%)
 Frame = +2

Query: 269 CSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCICCRLPI 448
           C   C  +C   C+  C  +CC +SG  CC A++  C    A+       +CC    +P 
Sbjct: 226 CVAGCAAKCAAACA--CAATCCTNSGASCCAAVVLGCVCTAAA-------ACCTVAFIP- 275

Query: 449 WSSTSSTFPVWICTSVCSI 505
           ++  + +  + ICT + ++
Sbjct: 276 YALMAFSILISICTVIQTV 294


>UniRef50_Q9GQC2 Cluster: Ras guanine nucleotide exchange factor
            RasGEFB; n=3; Dictyostelium discoideum|Rep: Ras guanine
            nucleotide exchange factor RasGEFB - Dictyostelium
            discoideum (Slime mold)
          Length = 1529

 Score = 41.1 bits (92), Expect = 0.022
 Identities = 28/109 (25%), Positives = 54/109 (49%), Gaps = 4/109 (3%)
 Frame = -1

Query: 564  STNKSFVLSLCRKALCSFSSIEQTLVQIHT-GNVLEVLDHMGSRQHMQQEQGECREP--L 394
            ++  S+   +   A  SFSS  QT     +  ++ ++L     +Q  QQ+Q + ++P  +
Sbjct: 689  ASTSSYTTPVSSSASLSFSSSTQTPSSAASQHHIQQILQQQQQQQQQQQQQQQQQQPQQI 748

Query: 393  AGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQ-L*EQQMELHR 250
                Q QH   +Q +     QQ+     +QQ+ Q+++Q   +QQ +L+R
Sbjct: 749  QSQSQQQHQQQQQQQQQQQQQQQQQQQQQQQQQQQQIQSQSQQQQQLNR 797


>UniRef50_Q9BYR4 Cluster: Keratin-associated protein 4-3; n=53;
           Mammalia|Rep: Keratin-associated protein 4-3 - Homo
           sapiens (Human)
          Length = 195

 Score = 41.1 bits (92), Expect = 0.022
 Identities = 32/99 (32%), Positives = 40/99 (40%), Gaps = 8/99 (8%)
 Frame = +2

Query: 227 RPSLLP*PLCNSICCSYSCTL----RCTFCCSNRCGTSCCPSSGILCCFAILC--WCCSN 388
           RPS      C + CC  SC +    R + C S+ C  SCC ++   CC    C   CC  
Sbjct: 26  RPSCCQTTCCRTTCCRPSCCISSCCRPSCCISSCCKPSCCRTT---CCRPSCCISSCCRP 82

Query: 389 PASGSLHSPCSCC--ICCRLPIWSSTSSTFPVWICTSVC 499
               S     SCC   CCR P    +S   P    +S C
Sbjct: 83  SCCISSCCKPSCCRTTCCR-PSCCISSCCRPSCCISSCC 120



 Score = 38.7 bits (86), Expect = 0.11
 Identities = 26/75 (34%), Positives = 31/75 (41%), Gaps = 4/75 (5%)
 Frame = +2

Query: 227 RPSLLP*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC--WCCSNPASG 400
           +PS      C   CC  SC  R + C S+ C  SCC ++   CC    C   CC      
Sbjct: 61  KPSCCRTTCCRPSCCISSCC-RPSCCISSCCKPSCCRTT---CCRPSCCISSCCRPSCCI 116

Query: 401 SLHSPCSCC--ICCR 439
           S     SCC   CCR
Sbjct: 117 SSCCKPSCCQTTCCR 131



 Score = 37.5 bits (83), Expect = 0.26
 Identities = 31/95 (32%), Positives = 33/95 (34%), Gaps = 4/95 (4%)
 Frame = +2

Query: 227 RPSLLP*PLCNSICCSYSCTLRCTFCCSNRC-GTSCCPSSGILCCFAILC--WCCSNPAS 397
           RPS      C   CC  SC      CC   C   SCC SS   CC    C   CC     
Sbjct: 71  RPSCCISSCCRPSCCISSCCKPS--CCRTTCCRPSCCISS---CCRPSCCISSCCKPSCC 125

Query: 398 GSLHSPCSCCI-CCRLPIWSSTSSTFPVWICTSVC 499
            +     SCCI  C  P     S   P    +S C
Sbjct: 126 QTTCCRPSCCISSCYRPQCCQPSCCRPACCISSCC 160



 Score = 37.5 bits (83), Expect = 0.26
 Identities = 29/85 (34%), Positives = 37/85 (43%), Gaps = 15/85 (17%)
 Frame = +2

Query: 254 CNSICCSYSCTL----RCTFCCSNRCGTSCC------PSSGILCCFAILCW--CCSNPAS 397
           C + CC  SC +    R + C S+ C  SCC      PS  I  C+   C    C  PA 
Sbjct: 95  CRTTCCRPSCCISSCCRPSCCISSCCKPSCCQTTCCRPSCCISSCYRPQCCQPSCCRPAC 154

Query: 398 GSLHSPC--SCCI-CCRLPIWSSTS 463
             + S C  SCC+  CR P    T+
Sbjct: 155 -CISSCCHPSCCVSSCRCPFSCPTT 178



 Score = 36.3 bits (80), Expect = 0.61
 Identities = 25/84 (29%), Positives = 32/84 (38%), Gaps = 5/84 (5%)
 Frame = +2

Query: 227 RPSLLP*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGI--LCCFAILCW--CCSNPA 394
           RPS      C   CC  +C  R + C S+     CC  S     CC +  C   CC +  
Sbjct: 111 RPSCCISSCCKPSCCQTTCC-RPSCCISSCYRPQCCQPSCCRPACCISSCCHPSCCVSSC 169

Query: 395 SGSLHSPCSCC-ICCRLPIWSSTS 463
                 P +CC   C  PI   +S
Sbjct: 170 RCPFSCPTTCCRTTCFHPICCGSS 193



 Score = 35.5 bits (78), Expect = 1.1
 Identities = 29/89 (32%), Positives = 36/89 (40%), Gaps = 7/89 (7%)
 Frame = +2

Query: 254 CNSICCSYSCT--LRCTFCCS-NRCGTSCCPSSGILCCFAILC--WCCSNPASGSLHSPC 418
           C S+C   SC   L    CC  + C T+CC ++   CC    C   CC      S     
Sbjct: 6   CGSVCSDQSCGQGLGQESCCRPSCCQTTCCRTT---CCRPSCCISSCCRPSCCISSCCKP 62

Query: 419 SCC--ICCRLPIWSSTSSTFPVWICTSVC 499
           SCC   CCR P    +S   P    +S C
Sbjct: 63  SCCRTTCCR-PSCCISSCCRPSCCISSCC 90


>UniRef50_UPI00015531D6 Cluster: PREDICTED: hypothetical protein;
           n=2; Mus musculus|Rep: PREDICTED: hypothetical protein -
           Mus musculus
          Length = 260

 Score = 40.7 bits (91), Expect = 0.028
 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 2/72 (2%)
 Frame = -1

Query: 456 LDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPH--LLEQQKVQRRV 283
           L+    ++H Q E+ + ++    LE+ Q     Q    L  QQ+  H  L EQQ+ Q+  
Sbjct: 74  LEEQQQQKHHQLEEQQQQQKHQQLEEQQQQQKHQQHQQLEEQQQQKHQQLEEQQQQQKHQ 133

Query: 282 QL*EQQMELHRG 247
           QL EQQ + H+G
Sbjct: 134 QLEEQQQQKHQG 145



 Score = 32.7 bits (71), Expect = 7.5
 Identities = 20/81 (24%), Positives = 40/81 (49%)
 Frame = -1

Query: 492 LVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHL 313
           L+ +H   ++ V  H      ++++Q +  + L   +Q +H   ++ +     QQ +   
Sbjct: 44  LMTVHFPKLMTV--HFPKHHTLEEQQQQKHQQLEEQQQQKHHQLEEQQQQQKHQQ-LEEQ 100

Query: 312 LEQQKVQRRVQL*EQQMELHR 250
            +QQK Q+  QL EQQ + H+
Sbjct: 101 QQQQKHQQHQQLEEQQQQKHQ 121


>UniRef50_UPI00006CCBE4 Cluster: hypothetical protein
           TTHERM_00439280; n=1; Tetrahymena thermophila SB210|Rep:
           hypothetical protein TTHERM_00439280 - Tetrahymena
           thermophila SB210
          Length = 573

 Score = 40.7 bits (91), Expect = 0.028
 Identities = 18/58 (31%), Positives = 23/58 (39%)
 Frame = +2

Query: 257 NSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCI 430
           N  CC + C      CC + C    C      CC    C C +   S  + S CSCC+
Sbjct: 484 NGDCCCFECCHDIGDCCFHLCSPQGCCEDMCKCCSKTTCDCIN---SDCIASTCSCCV 538


>UniRef50_A0NCB1 Cluster: ENSANGP00000030172; n=5; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000030172 - Anopheles gambiae
           str. PEST
          Length = 374

 Score = 40.7 bits (91), Expect = 0.028
 Identities = 25/71 (35%), Positives = 34/71 (47%), Gaps = 1/71 (1%)
 Frame = +2

Query: 251 LCNS-ICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           +C+S +CCS S  +R    C   C     PSS ++ C       C  P SG + +P  C 
Sbjct: 16  ICSSGLCCSSSGVVRSPSRCKAPCRFP-IPSSSVVVCTPSR---CKTPCSGVVCTPSRCK 71

Query: 428 ICCRLPIWSST 460
             CR PI SS+
Sbjct: 72  APCRFPITSSS 82



 Score = 36.3 bits (80), Expect = 0.61
 Identities = 24/88 (27%), Positives = 34/88 (38%), Gaps = 9/88 (10%)
 Frame = +2

Query: 263 ICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCW--CCSNP-------ASGSLHSP 415
           +C    C   C F  ++  G  C PS     C  ++C    C  P       +SG + +P
Sbjct: 148 VCTPSRCKAPCRFPITSSSGVMCTPSRCKAPCSGVMCTPSRCKTPCRFAIRSSSGVVCTP 207

Query: 416 CSCCICCRLPIWSSTSSTFPVWICTSVC 499
             C   CR PI SS+        C + C
Sbjct: 208 SRCKAPCRFPITSSSGVMCTPSRCKAPC 235



 Score = 34.3 bits (75), Expect = 2.5
 Identities = 23/70 (32%), Positives = 31/70 (44%), Gaps = 1/70 (1%)
 Frame = +2

Query: 254 CNSICCSYS-CTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCI 430
           C+ + C+ S C   C F   +  G  C PS     C A  C      +SG + +P  C  
Sbjct: 179 CSGVMCTPSRCKTPCRFAIRSSSGVVCTPSR----CKA-PCRFPITSSSGVMCTPSRCKA 233

Query: 431 CCRLPIWSST 460
            CR PI SS+
Sbjct: 234 PCRFPITSSS 243


>UniRef50_Q6AWT8 Cluster: At5g20635; n=1; Arabidopsis thaliana|Rep:
           At5g20635 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 251

 Score = 40.3 bits (90), Expect = 0.038
 Identities = 25/81 (30%), Positives = 30/81 (37%), Gaps = 2/81 (2%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSC-CPSSGILCCFAILCWCCSNPASGSLHSPCSCCI 430
           C+  CCS  C      C S  C   C C    + CC       CS      L+   S C 
Sbjct: 153 CDGSCCSNICCCPRLSCPSCSCFRGCWCSCPDMSCCIPSCFRSCSCTRPSCLNKKKSSCC 212

Query: 431 CCRLPI-WSSTSSTFPVWICT 490
            C   I WSS  S   V +C+
Sbjct: 213 SCNCKIRWSSCFSCPKVRLCS 233


>UniRef50_Q2I0E2 Cluster: Grain length and weight protein; n=2;
           Oryza sativa|Rep: Grain length and weight protein -
           Oryza sativa subsp. indica (Rice)
          Length = 232

 Score = 40.3 bits (90), Expect = 0.038
 Identities = 25/88 (28%), Positives = 31/88 (35%), Gaps = 4/88 (4%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAIL----CWCCSNPASGSLHSPCS 421
           C +      C  R   CC  RC   CC   G+  C +      C CC+ P +G     CS
Sbjct: 147 CGAALTKSPCRCRRRSCCCRRC---CCGGVGVRACASCSCSPPCACCAPPCAG-----CS 198

Query: 422 CCICCRLPIWSSTSSTFPVWICTSVCSI 505
           C   C  P     S   P   C   C +
Sbjct: 199 CRCTCPCPCPGGCSCACPA--CRCCCGV 224



 Score = 33.5 bits (73), Expect = 4.3
 Identities = 23/75 (30%), Positives = 33/75 (44%)
 Frame = +2

Query: 275 YSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCICCRLPIWS 454
           + C  R + CC +     CC SS    C +      S+ +S +L  P SCC  C     S
Sbjct: 89  FRCLCRASACCLSYLSWICCCSSAAGGCSS------SSSSSFNLKRP-SCCCNCNCNCCS 141

Query: 455 STSSTFPVWICTSVC 499
           S+SS+    +  S C
Sbjct: 142 SSSSSCGAALTKSPC 156


>UniRef50_O14686 Cluster: Myeloid/lymphoid or mixed-lineage leukemia
            protein 2; n=24; cellular organisms|Rep: Myeloid/lymphoid
            or mixed-lineage leukemia protein 2 - Homo sapiens
            (Human)
          Length = 5262

 Score = 40.3 bits (90), Expect = 0.038
 Identities = 32/115 (27%), Positives = 58/115 (50%), Gaps = 1/115 (0%)
 Frame = -1

Query: 525  ALCSFSSIEQTLVQIHTGNVLEVLDHMGSRQHMQQEQG-ECREPLAGLEQHQHSMAKQHR 349
            ++   S ++Q+L+  H+G        MGS Q +QQ+Q  + ++ L   +Q Q    +Q +
Sbjct: 3594 SMAGLSHLQQSLMS-HSGQPKLSAQPMGSLQQLQQQQQLQQQQQLQQQQQQQLQQQQQLQ 3652

Query: 348  MPLLGQQEVPHLLEQQKVQRRVQL*EQQMELHRGYGRSEGRCCYQRTQCPAGDIN 184
               L QQ+    L+QQ+ Q   QL +QQ +L +   + + +   Q+ Q   G +N
Sbjct: 3653 QQQLQQQQQQQQLQQQQQQ---QLQQQQQQLQQQQQQQQQQFQQQQQQQQMGLLN 3704



 Score = 35.1 bits (77), Expect = 1.4
 Identities = 20/64 (31%), Positives = 35/64 (54%), Gaps = 3/64 (4%)
 Frame = -1

Query: 441  SRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQ---EVPHLLEQQKVQRRVQL*E 271
            ++Q  QQ+Q + +  +AGL   Q S+      P L  Q    +  L +QQ++Q++ QL +
Sbjct: 3580 AQQQQQQQQHQQQGSMAGLSHLQQSLMSHSGQPKLSAQPMGSLQQLQQQQQLQQQQQLQQ 3639

Query: 270  QQME 259
            QQ +
Sbjct: 3640 QQQQ 3643


>UniRef50_UPI000155F1D6 Cluster: PREDICTED: similar to keratin
           associated protein 9.3; n=1; Equus caballus|Rep:
           PREDICTED: similar to keratin associated protein 9.3 -
           Equus caballus
          Length = 302

 Score = 39.9 bits (89), Expect = 0.050
 Identities = 23/66 (34%), Positives = 30/66 (45%), Gaps = 6/66 (9%)
 Frame = +2

Query: 248 PLCN-SICCSYSCTLR--CTFCC-SNRCGTSCCPSSGI--LCCFAILCWCCSNPASGSLH 409
           P C+ S CC  +C+    C  CC   RC T+CC ++     C  +    CCS P      
Sbjct: 12  PTCSESSCCGQTCSQSSCCQPCCPQTRCQTTCCRTTCYQPTCVTSCRPSCCSAPCCQPTC 71

Query: 410 SPCSCC 427
           S  SCC
Sbjct: 72  SESSCC 77



 Score = 39.5 bits (88), Expect = 0.066
 Identities = 30/97 (30%), Positives = 38/97 (39%), Gaps = 15/97 (15%)
 Frame = +2

Query: 254 CNSICCSYS-CTLRC--TFCCSNRCGTSCCPSSGILCCFAIL--CWCCSNPAS-GSLHSP 415
           C   CC  + C   C  T C    C TSCCP+    CC        CC    S  S   P
Sbjct: 86  CYQPCCPQTRCQTTCCRTTCYQPTCVTSCCPAP---CCQPTCSESSCCGQTCSRSSCCQP 142

Query: 416 C---SCC--ICCRL----PIWSSTSSTFPVWICTSVC 499
           C   +CC  ICC+     P++   +   P  +C   C
Sbjct: 143 CCPPACCQTICCQPACSGPVYCRRTCYHPTCVCLPCC 179



 Score = 37.9 bits (84), Expect = 0.20
 Identities = 25/82 (30%), Positives = 34/82 (41%), Gaps = 4/82 (4%)
 Frame = +2

Query: 242 P*PLCNSICCSYSCT--LRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPA--SGSLH 409
           P   C +ICC  +C+  + C   C +     C P      C +  C  C +PA    S  
Sbjct: 145 PPACCQTICCQPACSGPVYCRRTCYHPTCV-CLPCCQAQSCGSSCCQPCCHPACCESSCC 203

Query: 410 SPCSCCICCRLPIWSSTSSTFP 475
            P SCC  C  P  S +S + P
Sbjct: 204 QP-SCCCTCCQPTCSGSSCSLP 224


>UniRef50_UPI00006A07FB Cluster: UPI00006A07FB related cluster; n=1;
           Xenopus tropicalis|Rep: UPI00006A07FB UniRef100 entry -
           Xenopus tropicalis
          Length = 177

 Score = 39.9 bits (89), Expect = 0.050
 Identities = 23/82 (28%), Positives = 34/82 (41%)
 Frame = +2

Query: 251 LCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCI 430
           +C S+ C    +L+C  C S +C    C S     C ++ CW C +       S   C +
Sbjct: 10  VCLSLQCWVCLSLQCWVCLSLQCWV--CLSLQCWVCLSLQCWVCLSLQCWVCLS-LQCWV 66

Query: 431 CCRLPIWSSTSSTFPVWICTSV 496
           C  L  W   S     W+C S+
Sbjct: 67  CLSLQCWVCLS--LQCWVCLSL 86


>UniRef50_A0TEK5 Cluster: Putative uncharacterized protein; n=1;
           Burkholderia ambifaria MC40-6|Rep: Putative
           uncharacterized protein - Burkholderia ambifaria MC40-6
          Length = 649

 Score = 39.9 bits (89), Expect = 0.050
 Identities = 26/87 (29%), Positives = 44/87 (50%), Gaps = 3/87 (3%)
 Frame = -1

Query: 534 CRKALCSFSSIEQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQ 355
           CR+ + +   +E+ + Q+   ++  V+DH G R    +E  E   P A LEQ +H + + 
Sbjct: 41  CRRPVVAPYVVEEVVRQMLAADLAVVVDHRGRRTQQVRELPEIARPRAALEQ-RHHVGRD 99

Query: 354 HRMPLLG-QQEVP--HLLEQQKVQRRV 283
            + P  G +Q  P  HLL+  +  R V
Sbjct: 100 AQRPAPGPRQRFPLQHLLDDHREVRPV 126


>UniRef50_Q4UFM9 Cluster: Putative uncharacterized protein; n=2;
           Theileria|Rep: Putative uncharacterized protein -
           Theileria annulata
          Length = 1506

 Score = 39.9 bits (89), Expect = 0.050
 Identities = 23/64 (35%), Positives = 28/64 (43%), Gaps = 13/64 (20%)
 Frame = +2

Query: 284 TLRCTFCC----SNRCGTSCC--PSSGILCCFAILCWC-------CSNPASGSLHSPCSC 424
           T  CT CC    +N C  +C   P +   CC   LC C       CS   +G+    C C
Sbjct: 788 TSECTCCCKKQGNNGCQCTCSTSPPANCKCCLCCLC-CPADNSKGCSCDCAGTPKKCCIC 846

Query: 425 CICC 436
           CICC
Sbjct: 847 CICC 850



 Score = 36.7 bits (81), Expect = 0.46
 Identities = 20/67 (29%), Positives = 26/67 (38%), Gaps = 9/67 (13%)
 Frame = +2

Query: 266  CCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAI---------LCWCCSNPASGSLHSPC 418
            CC   C + C  C + + G  CC  +   CC             C CCS   SG     C
Sbjct: 843  CCI--CCICCEACQTKKGGCDCCNGNTGKCCVCCEKCPKTCSEKCACCSKDCSGCC---C 897

Query: 419  SCCICCR 439
             CC+ C+
Sbjct: 898  MCCLICK 904



 Score = 33.1 bits (72), Expect = 5.7
 Identities = 19/66 (28%), Positives = 22/66 (33%), Gaps = 3/66 (4%)
 Frame = +2

Query: 248  PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASG---SLHSPC 418
            P  N  CC   C L C    S  C   C  +    C   I C  C     G      +  
Sbjct: 811  PPANCKCCL--CCLCCPADNSKGCSCDCAGTPKKCCICCICCEACQTKKGGCDCCNGNTG 868

Query: 419  SCCICC 436
             CC+CC
Sbjct: 869  KCCVCC 874


>UniRef50_A7SFM6 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 163

 Score = 39.9 bits (89), Expect = 0.050
 Identities = 23/85 (27%), Positives = 38/85 (44%), Gaps = 7/85 (8%)
 Frame = +2

Query: 257 NSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPA---SGSLHSPCSCC 427
           NS+ C Y+CT      C++     C  S    C  ++ CWC ++ A   + SL   C+  
Sbjct: 59  NSLACWYTCTNSLACWCTDSLARLCKNSLARWCTDSLSCWCTNSLARWCTNSLARWCTSS 118

Query: 428 ICC----RLPIWSSTSSTFPVWICT 490
           + C     L  W + +++   W CT
Sbjct: 119 LACWCSNSLACWYTCTNSLACW-CT 142


>UniRef50_Q9ICF9 Cluster: Uncharacterized protein FPV002/FPV259;
           n=3; Avipoxvirus|Rep: Uncharacterized protein
           FPV002/FPV259 - Fowlpox virus (FPV)
          Length = 222

 Score = 39.9 bits (89), Expect = 0.050
 Identities = 22/56 (39%), Positives = 25/56 (44%)
 Frame = +2

Query: 281 CTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCICCRLPI 448
           C LRC  C S R  T  C    +L  F + C C S       HS   CC CC LP+
Sbjct: 15  CLLRCFLCNSVRPATCKCVHC-LLYPFEVCCECMSETLDSLEHS---CCYCCVLPL 66


>UniRef50_UPI00015B60AD Cluster: PREDICTED: hypothetical protein;
           n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical
           protein - Nasonia vitripennis
          Length = 119

 Score = 39.5 bits (88), Expect = 0.066
 Identities = 15/22 (68%), Positives = 21/22 (95%)
 Frame = +1

Query: 136 GYAQAIPQNIPPYAAQVNIASR 201
           GYA A+PQNIPP+A++V+I+SR
Sbjct: 35  GYAHAVPQNIPPFASRVDISSR 56


>UniRef50_Q8IBA9 Cluster: Putative uncharacterized protein
           PF08_0013; n=3; Plasmodium|Rep: Putative uncharacterized
           protein PF08_0013 - Plasmodium falciparum (isolate 3D7)
          Length = 943

 Score = 39.5 bits (88), Expect = 0.066
 Identities = 22/49 (44%), Positives = 24/49 (48%), Gaps = 3/49 (6%)
 Frame = +2

Query: 266 CCSYSCTLRCTFCCSN-RCGTSCCPSSGILCCFAILC--WCCSNPASGS 403
           CCS SC      CCSN RC  SCC +S   CC    C   CC+N    S
Sbjct: 715 CCSNSCCSNS--CCSNSRCSNSCCSNS---CCNNSCCNNSCCNNSCCNS 758


>UniRef50_Q7YWV7 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 212

 Score = 39.5 bits (88), Expect = 0.066
 Identities = 23/61 (37%), Positives = 24/61 (39%), Gaps = 1/61 (1%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASG-SLHSPCSCCI 430
           C   CC   C  RC  CC  RC T CC +    CC    C CC     G      C CC 
Sbjct: 82  CGCGCCC--CRPRCC-CCCRRCCT-CCRT----CCCTRCCTCCRPCCCGCGCGCGCGCCG 133

Query: 431 C 433
           C
Sbjct: 134 C 134



 Score = 36.7 bits (81), Expect = 0.46
 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 3/52 (5%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCC---FAILCWCCSNPASG 400
           C   CC   C  RC  CC   C T CC      CC       C CC     G
Sbjct: 89  CRPRCCC--CCRRCCTCCRTCCCTRCCTCCRPCCCGCGCGCGCGCCGCGGGG 138



 Score = 34.3 bits (75), Expect = 2.5
 Identities = 17/47 (36%), Positives = 19/47 (40%), Gaps = 1/47 (2%)
 Frame = +2

Query: 302 CCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCS-CCICCR 439
           CC   CG  CC      CC    C CC    +      C+ CC CCR
Sbjct: 79  CCG--CGCGCC------CCRPRCCCCCRRCCTCCRTCCCTRCCTCCR 117


>UniRef50_A3LS86 Cluster: Predicted protein; n=1; Pichia
           stipitis|Rep: Predicted protein - Pichia stipitis
           (Yeast)
          Length = 1527

 Score = 39.5 bits (88), Expect = 0.066
 Identities = 21/61 (34%), Positives = 35/61 (57%), Gaps = 2/61 (3%)
 Frame = -1

Query: 435 QHMQQEQGECREPLAGLEQ--HQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQM 262
           QH Q      ++PL GL+Q  HQ    +Q + PL  QQ++  + +QQ +Q++ Q  +QQ 
Sbjct: 622 QH-QHRHSPPQQPLRGLQQQPHQSIQQQQQQQPLSSQQQIQQIQQQQYLQQQQQQQQQQQ 680

Query: 261 E 259
           +
Sbjct: 681 Q 681


>UniRef50_UPI000155483C Cluster: PREDICTED: similar to keratin
           associated protein; n=8; Ornithorhynchus anatinus|Rep:
           PREDICTED: similar to keratin associated protein -
           Ornithorhynchus anatinus
          Length = 399

 Score = 39.1 bits (87), Expect = 0.087
 Identities = 26/83 (31%), Positives = 33/83 (39%), Gaps = 1/83 (1%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCS-NRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCI 430
           C S C   +C L CT  CS + C  SCC  S   CC    C   +N  S      C    
Sbjct: 227 CQSSCGPSTCQLACTGSCSPSCCQDSCCQQS---CC-QDSCGQSANCQSAGCEDSCCLPT 282

Query: 431 CCRLPIWSSTSSTFPVWICTSVC 499
           CC+ P+        PV   ++ C
Sbjct: 283 CCK-PVCCVPVGREPVCCVSTPC 304



 Score = 32.3 bits (70), Expect = 10.0
 Identities = 25/75 (33%), Positives = 28/75 (37%), Gaps = 13/75 (17%)
 Frame = +2

Query: 254 CNSICC--SYSCTLRCTFCCSNRCGTSC--CPSSGILCCFAILCW-------CCSNPASG 400
           C + CC  +    L C   C   CGT C    S G   C A  C        CC +   G
Sbjct: 40  CPTPCCRPASRVALLCRPACGAPCGTGCGSASSCGDGPCQASCCQPACGRDSCCGSVCCG 99

Query: 401 SLHSPCSCC--ICCR 439
           S     SCC   CCR
Sbjct: 100 SGPCQSSCCQPSCCR 114


>UniRef50_UPI0001553357 Cluster: PREDICTED: similar to novel member
           of the keratin associated protein 4 (Krtap4) family;
           n=1; Mus musculus|Rep: PREDICTED: similar to novel
           member of the keratin associated protein 4 (Krtap4)
           family - Mus musculus
          Length = 292

 Score = 39.1 bits (87), Expect = 0.087
 Identities = 35/94 (37%), Positives = 41/94 (43%), Gaps = 10/94 (10%)
 Frame = +2

Query: 248 PLC-NSICCSYSCTLRCTFCCSNRCGTSCCPS---SGILC---CFAILC-WCC-SNPASG 400
           P C NS CC  S + R T C S+ C   CCPS       C   C +  C  CC S+   G
Sbjct: 67  PSCVNSSCCG-SSSCRPTCCVSSCCRPQCCPSVCYQPSCCRSSCRSSRCRLCCGSSSCCG 125

Query: 401 SLHSPCSCCICC-RLPIWSSTSSTFPVWICTSVC 499
           S +   SCCI   R P    +S   P   C S C
Sbjct: 126 SSYYRPSCCISSYRRPTCCISSYCRPS-CCQSTC 158



 Score = 38.3 bits (85), Expect = 0.15
 Identities = 26/68 (38%), Positives = 30/68 (44%), Gaps = 6/68 (8%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCC-PSSGILCCFAILCWC--CSNPA-SGSLHSPCS 421
           C   CC  SC  R   C S  C  +CC PS  I  C    C C  C N +  GS     +
Sbjct: 25  CRPSCCVSSCC-RPQCCQSVCCQPTCCHPSCCISSCRVSSCCCPSCVNSSCCGSSSCRPT 83

Query: 422 CCI--CCR 439
           CC+  CCR
Sbjct: 84  CCVSSCCR 91



 Score = 37.9 bits (84), Expect = 0.20
 Identities = 27/84 (32%), Positives = 33/84 (39%), Gaps = 2/84 (2%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCW--CCSNPASGSLHSPCSCC 427
           C   CC  +C  R + C S+ C   CC S   +CC    C   CC    S    S C CC
Sbjct: 15  CGQSCCQTTCC-RPSCCVSSCCRPQCCQS---VCCQPTCCHPSCC---ISSCRVSSC-CC 66

Query: 428 ICCRLPIWSSTSSTFPVWICTSVC 499
             C       +SS  P    +S C
Sbjct: 67  PSCVNSSCCGSSSCRPTCCVSSCC 90



 Score = 37.5 bits (83), Expect = 0.26
 Identities = 25/79 (31%), Positives = 31/79 (39%), Gaps = 8/79 (10%)
 Frame = +2

Query: 227 RPSLLP*PLCNSICCSYSCTL---RCTFCCSNRC-GTSCCPSSGI--LCCFAILC--WCC 382
           RP       C   CC  SC +   R + CC   C  +SCC SS     CC +  C   CC
Sbjct: 36  RPQCCQSVCCQPTCCHPSCCISSCRVSSCCCPSCVNSSCCGSSSCRPTCCVSSCCRPQCC 95

Query: 383 SNPASGSLHSPCSCCICCR 439
            +      + P  C   CR
Sbjct: 96  PSVC----YQPSCCRSSCR 110



 Score = 36.3 bits (80), Expect = 0.61
 Identities = 25/75 (33%), Positives = 30/75 (40%), Gaps = 7/75 (9%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTS--CCPSS-GILCCFAILC--WCCSNPASGSLHSPC 418
           C S+CC  +C      CC + C  S  CCPS     CC +  C   CC +        P 
Sbjct: 40  CQSVCCQPTCC--HPSCCISSCRVSSCCCPSCVNSSCCGSSSCRPTCCVSSCCRPQCCPS 97

Query: 419 SCC--ICCRLPIWSS 457
            C    CCR    SS
Sbjct: 98  VCYQPSCCRSSCRSS 112



 Score = 32.3 bits (70), Expect = 10.0
 Identities = 22/65 (33%), Positives = 30/65 (46%), Gaps = 6/65 (9%)
 Frame = +2

Query: 260 SICCSYSCTLRCTFCCSNRCGTSCCPSSGI--LCCFAILCW---CC-SNPASGSLHSPCS 421
           S CC  SC +  + C S+ C  +CC SS     CC ++ C+   CC S+  S      C 
Sbjct: 62  SSCCCPSC-VNSSCCGSSSCRPTCCVSSCCRPQCCPSV-CYQPSCCRSSCRSSRCRLCCG 119

Query: 422 CCICC 436
              CC
Sbjct: 120 SSSCC 124


>UniRef50_UPI0000E46904 Cluster: PREDICTED: similar to putative
           porin precursor; n=2; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to putative porin precursor -
           Strongylocentrotus purpuratus
          Length = 764

 Score = 39.1 bits (87), Expect = 0.087
 Identities = 19/61 (31%), Positives = 25/61 (40%)
 Frame = +2

Query: 251 LCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCI 430
           LC  +C   S       CCSN CG  C   +  L C A+LC       +      C+ C+
Sbjct: 696 LCAELCTDDSSCAANQKCCSNGCGHECIDMT--LICPAVLCMIFCEHGTQKDERGCNTCV 753

Query: 431 C 433
           C
Sbjct: 754 C 754


>UniRef50_Q2LXE0 Cluster: Hypothetical membrane protein; n=1;
           Syntrophus aciditrophicus SB|Rep: Hypothetical membrane
           protein - Syntrophus aciditrophicus (strain SB)
          Length = 125

 Score = 39.1 bits (87), Expect = 0.087
 Identities = 20/62 (32%), Positives = 26/62 (41%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCIC 433
           CNS+C S SC+L C+  C   C   C    G  C       C S+ + G  H    C   
Sbjct: 57  CNSMCAS-SCSLSCSGRCDGTCQDGCSSGCGSTCVRTCADDCGSSCSGGCAHVCGGCDGT 115

Query: 434 CR 439
           C+
Sbjct: 116 CK 117



 Score = 32.3 bits (70), Expect = 10.0
 Identities = 18/63 (28%), Positives = 22/63 (34%), Gaps = 3/63 (4%)
 Frame = +2

Query: 248 PLCNSICCSYSCTLRCTFCCSNRCGTSC---CPSSGILCCFAILCWCCSNPASGSLHSPC 418
           P   S  C+  C   C+  CS RC  +C   C S     C       C +  SG     C
Sbjct: 50  PQSVSANCNSMCASSCSLSCSGRCDGTCQDGCSSGCGSTCVRTCADDCGSSCSGGCAHVC 109

Query: 419 SCC 427
             C
Sbjct: 110 GGC 112


>UniRef50_Q4UH31 Cluster: Integral membrane protein, putative; n=2;
            Eukaryota|Rep: Integral membrane protein, putative -
            Theileria annulata
          Length = 978

 Score = 39.1 bits (87), Expect = 0.087
 Identities = 21/70 (30%), Positives = 26/70 (37%), Gaps = 10/70 (14%)
 Frame = +2

Query: 257  NSICCSYSCTLRCTFCCSNRC--------GTSCCPSSGILCCFAI--LCWCCSNPASGSL 406
            +S CC   CT +C  C   +C           CC +    CC      C CC N    S 
Sbjct: 845  DSCCCC--CTKKCLCCICRKCCCCKKPSTQCDCCKTDASQCCCKSPDSCDCCKNTKCSSN 902

Query: 407  HSPCSCCICC 436
             + C CC  C
Sbjct: 903  GTDCKCCTKC 912



 Score = 35.1 bits (77), Expect = 1.4
 Identities = 14/48 (29%), Positives = 16/48 (33%)
 Frame = +2

Query: 296 TFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCICCR 439
           T CC    G  C       CC    C CC          P + C CC+
Sbjct: 830 TCCCKKESGCECQIKDSCCCCCTKKCLCCICRKCCCCKKPSTQCDCCK 877



 Score = 33.9 bits (74), Expect = 3.3
 Identities = 16/51 (31%), Positives = 20/51 (39%), Gaps = 2/51 (3%)
 Frame = +2

Query: 293 CTFCCSNRCGTSCCPSSGILCCF--AILCWCCSNPASGSLHSPCSCCICCR 439
           C  CC+ +C   CC      CC   +  C CC   AS         C CC+
Sbjct: 847 CCCCCTKKC--LCCICRKCCCCKKPSTQCDCCKTDASQCCCKSPDSCDCCK 895


>UniRef50_Q17641 Cluster: Putative uncharacterized protein; n=11;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 197

 Score = 39.1 bits (87), Expect = 0.087
 Identities = 17/45 (37%), Positives = 17/45 (37%)
 Frame = +2

Query: 266 CCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASG 400
           CC   C   C  CC  RC T C P     CC    C CC     G
Sbjct: 95  CCCRRCCTCCRTCCCTRCCTCCRP-----CCCGCGCGCCGCGGGG 134



 Score = 37.5 bits (83), Expect = 0.26
 Identities = 22/56 (39%), Positives = 23/56 (41%)
 Frame = +2

Query: 266 CCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCIC 433
           CC   C  RC  CC  RC T CC +    CC    C CC     G     C CC C
Sbjct: 86  CCC--CRPRCC-CCCRRCCT-CCRT----CCCTRCCTCCRPCCCG---CGCGCCGC 130



 Score = 35.1 bits (77), Expect = 1.4
 Identities = 19/59 (32%), Positives = 21/59 (35%), Gaps = 1/59 (1%)
 Frame = +2

Query: 266 CCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCS-CCICCR 439
           CC   C   C  C     G  CC      CC    C CC    +      C+ CC CCR
Sbjct: 67  CCGCGCG--CCGCGGGGGGCGCC------CCRPRCCCCCRRCCTCCRTCCCTRCCTCCR 117



 Score = 33.1 bits (72), Expect = 5.7
 Identities = 13/31 (41%), Positives = 15/31 (48%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSG 346
           C + CC+  CT  C  CC   CG  CC   G
Sbjct: 104 CRTCCCTRCCTC-CRPCCCG-CGCGCCGCGG 132


>UniRef50_Q6ZW48 Cluster: CDNA FLJ41609 fis, clone CTONG3001560;
           n=1; Homo sapiens|Rep: CDNA FLJ41609 fis, clone
           CTONG3001560 - Homo sapiens (Human)
          Length = 143

 Score = 39.1 bits (87), Expect = 0.087
 Identities = 22/87 (25%), Positives = 36/87 (41%), Gaps = 10/87 (11%)
 Frame = +2

Query: 269 CSYSCTLRCTFCCSNRCGTSCCPSSGILC-----CFAILCWC-CSNPASGSLHSPCSC-- 424
           C++ C + C   C+  C  SCC    +LC     C   +C C C       L + C+C  
Sbjct: 53  CAHMCLVPCVCVCAWACVFSCCVRVLVLCVCTHVCLVTVCACACFVCVHACLVTACACAC 112

Query: 425 --CICCRLPIWSSTSSTFPVWICTSVC 499
             C+C  +    + +   P  +C  +C
Sbjct: 113 FVCVCMCVVTMCACACVLPC-VCVHLC 138



 Score = 34.7 bits (76), Expect = 1.9
 Identities = 17/65 (26%), Positives = 27/65 (41%), Gaps = 1/65 (1%)
 Frame = +2

Query: 251 LCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC- 427
           +C  +C    C   C F C + C  + C  +    CF  +C C     + +   PC C  
Sbjct: 82  VCTHVCLVTVCACAC-FVCVHACLVTACACA----CFVCVCMCVVTMCACACVLPCVCVH 136

Query: 428 ICCRL 442
           +C R+
Sbjct: 137 LCVRM 141


>UniRef50_P60410 Cluster: Keratin-associated protein 10-8; n=12;
           Eutheria|Rep: Keratin-associated protein 10-8 - Homo
           sapiens (Human)
          Length = 259

 Score = 39.1 bits (87), Expect = 0.087
 Identities = 28/91 (30%), Positives = 37/91 (40%), Gaps = 9/91 (9%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCC-SNRCGTSCCPSSGI--LCCFAILC--WCCSNPASGSLHSPC 418
           C  +CC   C+   + CC  + C ++CC  S     CC  I C   CC    SG+    C
Sbjct: 129 CKPVCCVSICSGASSPCCQQSSCQSACCTFSPCQQACCVPICCKPICCVPVCSGASSLCC 188

Query: 419 --SCC--ICCRLPIWSSTSSTFPVWICTSVC 499
             S C   CC       +SS     +C  VC
Sbjct: 189 QKSSCQPACCTTSCCRPSSSV--SLLCRPVC 217



 Score = 37.5 bits (83), Expect = 0.26
 Identities = 22/74 (29%), Positives = 29/74 (39%), Gaps = 3/74 (4%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCW--CCS-NPASGSLHSPCSC 424
           C   CC   C    + CC   C  S C  +   CC    C   CC+ +P   +   P  C
Sbjct: 114 CQQACCVPVCCK--SNCCKPVCCVSICSGASSPCCQQSSCQSACCTFSPCQQACCVPICC 171

Query: 425 CICCRLPIWSSTSS 466
              C +P+ S  SS
Sbjct: 172 KPICCVPVCSGASS 185



 Score = 34.3 bits (75), Expect = 2.5
 Identities = 26/87 (29%), Positives = 33/87 (37%), Gaps = 4/87 (4%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCT----FCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCS 421
           C S CC+ SC          C    C  S C S     C    C   S   +    SPC 
Sbjct: 56  CASSCCTPSCCAPAPCLALVCAPVSCEPSPCQSGCTDSCTPSCCQQSSCQPACCTSSPCQ 115

Query: 422 CCICCRLPIWSSTSSTFPVWICTSVCS 502
              CC +P+   ++   PV  C S+CS
Sbjct: 116 QA-CC-VPVCCKSNCCKPV-CCVSICS 139


>UniRef50_P60368 Cluster: Keratin-associated protein 10-2; n=64;
           Coelomata|Rep: Keratin-associated protein 10-2 - Homo
           sapiens (Human)
          Length = 255

 Score = 39.1 bits (87), Expect = 0.087
 Identities = 26/96 (27%), Positives = 37/96 (38%), Gaps = 12/96 (12%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGI-------LCCFAILC--WCCSNPASGSL 406
           C  +CC   C    + C  + C  +CC SS         +CC A+ C   C  + +S   
Sbjct: 105 CKPVCCVPVCCGASSCCQQSSCQPACCASSSCQQSCRVPVCCKAVCCVPTCSESSSSCCQ 164

Query: 407 HSPCSCCICCRLPIWSSTSSTF---PVWICTSVCSI 505
            S C    C   P   S   +    PV  C S+C +
Sbjct: 165 QSSCQPACCTSSPCQQSCCVSVCCKPV-CCKSICCV 199



 Score = 37.9 bits (84), Expect = 0.20
 Identities = 24/60 (40%), Positives = 30/60 (50%), Gaps = 7/60 (11%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCC-SNRCGTSCCPSSGILCC-----FAILCW-CCSNPASGSLHS 412
           C SICC   C+   + CC  + C  +CC SS   CC      ++LC   CS PAS S  S
Sbjct: 193 CKSICCVPVCSGASSPCCQQSSCQPACCTSS---CCRPSSSVSLLCRPVCSRPASCSFSS 249



 Score = 36.7 bits (81), Expect = 0.46
 Identities = 26/94 (27%), Positives = 34/94 (36%), Gaps = 8/94 (8%)
 Frame = +2

Query: 242 P*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPC- 418
           P P    +C   SC    + CC   C  S C S     C    C   S   +    SPC 
Sbjct: 39  PAPCLTLVCTPVSCV--SSPCCQAACEPSACQSGCTSSCTPSCCQQSSCQPACCTSSPCQ 96

Query: 419 -SCC--ICCR----LPIWSSTSSTFPVWICTSVC 499
            +CC  +CC+    +P+    SS      C   C
Sbjct: 97  QACCVPVCCKPVCCVPVCCGASSCCQQSSCQPAC 130



 Score = 34.3 bits (75), Expect = 2.5
 Identities = 25/88 (28%), Positives = 33/88 (37%), Gaps = 5/88 (5%)
 Frame = +2

Query: 251 LCNSICCSYSCTLRCT-FCCSNRCGT-SCCPSSGILCCFAILCWCCSNPASGSLHSPCSC 424
           +C+S C +      C   CC   CGT SCC  +  L        C S+P   +   P +C
Sbjct: 8   ICSSACTNSWQVDDCPESCCELPCGTPSCCAPAPCLTLVCTPVSCVSSPCCQAACEPSAC 67

Query: 425 ---CICCRLPIWSSTSSTFPVWICTSVC 499
              C     P     SS  P    +S C
Sbjct: 68  QSGCTSSCTPSCCQQSSCQPACCTSSPC 95


>UniRef50_Q95337 Cluster: Involucrin; n=11; Eutheria|Rep: Involucrin
           - Tupaia glis (Tree shrew)
          Length = 400

 Score = 39.1 bits (87), Expect = 0.087
 Identities = 28/107 (26%), Positives = 54/107 (50%), Gaps = 5/107 (4%)
 Frame = -1

Query: 486 QIHTGNVLEVLDHMGSRQHM-QQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLL 310
           ++H G   +  ++     H+ QQ+Q E +E    L QHQ   +++ ++  LGQQ+     
Sbjct: 103 ELHLGQQQQQQEYQEQELHLGQQQQQEYQEQELHLGQHQQQTSQEQKLH-LGQQQQHQES 161

Query: 309 EQQKVQRRVQL*E-QQMELHRGYGRSEGRCCY---QRTQCPAGDINL 181
           ++QK+    Q  E Q+ ELH G   ++    +   Q+ +C   +++L
Sbjct: 162 QEQKLHLEQQQQEPQKQELHLGQQEAQEEELHLKQQQQECQKEEVHL 208


>UniRef50_UPI0001554838 Cluster: PREDICTED: similar to solute
           carrier family 5 (sodium/glucose cotransporter), member
           9; n=1; Ornithorhynchus anatinus|Rep: PREDICTED: similar
           to solute carrier family 5 (sodium/glucose
           cotransporter), member 9 - Ornithorhynchus anatinus
          Length = 300

 Score = 38.7 bits (86), Expect = 0.11
 Identities = 24/73 (32%), Positives = 32/73 (43%), Gaps = 2/73 (2%)
 Frame = +2

Query: 227 RPSLLP*PLCNSICCSYSCTLRCTFCCSNRCGTSCC-PSSGILCCFAILCWCCSNPASGS 403
           R +LL  P C + C +   +  C  C    C  SCC P+ G   C   +C CCS     S
Sbjct: 105 RVALLCRPACGAPCGAGCGSASC--CGDGPCQASCCQPACGRDSCCGTVCCCCSPCCRPS 162

Query: 404 LHSPCSC-CICCR 439
              P  C  +CC+
Sbjct: 163 GCVPVCCEPVCCK 175



 Score = 35.5 bits (78), Expect = 1.1
 Identities = 26/92 (28%), Positives = 34/92 (36%), Gaps = 5/92 (5%)
 Frame = +2

Query: 227 RPSLLP*PLCNSICCSYSCTLRCTFCCSNRC-GTSCCPSSGILCCFAILC--WCCSNPAS 397
           RPS      C  +CC   C +    CC   C  T CC  +   CC    C   CC     
Sbjct: 160 RPSGCVPVCCEPVCCKPVCCV--PVCCEPTCCPTPCCRPASSPCCRPSCCVPVCCEPVRC 217

Query: 398 GSLHSPCSCC--ICCRLPIWSSTSSTFPVWIC 487
             +     CC  +CC+ P+    S+  P   C
Sbjct: 218 VPVCCKPVCCTPVCCK-PVLPRGSALPPGLRC 248



 Score = 32.7 bits (71), Expect = 7.5
 Identities = 22/66 (33%), Positives = 27/66 (40%), Gaps = 5/66 (7%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCF-AILCWCCSNPASGSLHSPCS--C 424
           C  +CC   C      C    C  +CCP+    CC  A  C  C  P SG +   C   C
Sbjct: 25  CEPVCCKPVCC-EPVCCVPVCCEPTCCPTP---CCRPASCCSPCCRP-SGCVPVCCKPVC 79

Query: 425 C--ICC 436
           C  +CC
Sbjct: 80  CEPVCC 85


>UniRef50_UPI0000E804BE Cluster: PREDICTED: hypothetical protein;
           n=1; Gallus gallus|Rep: PREDICTED: hypothetical protein
           - Gallus gallus
          Length = 233

 Score = 38.7 bits (86), Expect = 0.11
 Identities = 25/83 (30%), Positives = 32/83 (38%), Gaps = 8/83 (9%)
 Frame = +2

Query: 266 CCSYSCTLRCTFCCSNRCGTSCCPSSGILCC-------FAILCWCCSNPASGSLHSPCSC 424
           CC    T  C +  S      CC +  + CC         I CW   +  S   H P SC
Sbjct: 112 CCINLATSECCYHPS-----PCCTNPNVFCCHRDLSPPIPIFCWDALSWNSDKPHQPYSC 166

Query: 425 CICC-RLPIWSSTSSTFPVWICT 490
            ICC +  +  S S+  P   CT
Sbjct: 167 AICCLKHKLSLSNSAHHPTHHCT 189


>UniRef50_UPI0000D9AF71 Cluster: PREDICTED: hypothetical protein;
           n=1; Macaca mulatta|Rep: PREDICTED: hypothetical protein
           - Macaca mulatta
          Length = 445

 Score = 38.7 bits (86), Expect = 0.11
 Identities = 24/83 (28%), Positives = 33/83 (39%)
 Frame = +2

Query: 251 LCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCI 430
           +C  IC S  CT  C   C + C   C      +C +  +C C S     S+    S CI
Sbjct: 252 ICICICISIICTCVCICICISMCIYICICICISMCIYICICICISMCIYISICICISMCI 311

Query: 431 CCRLPIWSSTSSTFPVWICTSVC 499
              + I  S      + IC S+C
Sbjct: 312 YICICICISMCIYICICICISMC 334



 Score = 37.1 bits (82), Expect = 0.35
 Identities = 28/89 (31%), Positives = 37/89 (41%), Gaps = 6/89 (6%)
 Frame = +2

Query: 251 LCNSIC-CSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAI-LCWCCSNPASGSLH-SPCS 421
           +C  IC C   CT  C   C + C   C  S  +  C  I +C C S     S++   C 
Sbjct: 101 ICICICICISICTCICICICISICICICICSVCVCICTCICICICISICICISVYICICI 160

Query: 422 C---CICCRLPIWSSTSSTFPVWICTSVC 499
           C   CIC  + I    S    + IC S+C
Sbjct: 161 CIDVCICTCVCICICISMCISICICISMC 189



 Score = 32.7 bits (71), Expect = 7.5
 Identities = 22/84 (26%), Positives = 30/84 (35%), Gaps = 1/84 (1%)
 Frame = +2

Query: 251 LCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSC-C 427
           +C  IC    C   C   C   C + C      +C    +C C  +         C+C C
Sbjct: 86  ICICICSVCVCICTCICICICICISICTCICICICISICICICICSVCV----CICTCIC 141

Query: 428 ICCRLPIWSSTSSTFPVWICTSVC 499
           IC  + I    S    + IC  VC
Sbjct: 142 ICICISICICISVYICICICIDVC 165



 Score = 32.3 bits (70), Expect = 10.0
 Identities = 24/87 (27%), Positives = 33/87 (37%), Gaps = 4/87 (4%)
 Frame = +2

Query: 251 LCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSC-- 424
           +C  IC S  CT  C   C + C   C      +C +  +C C S      +   C C  
Sbjct: 204 ICICICISM-CTYTCICICISICTCVCICICISMCIYISICICISMCIYICI---CICIS 259

Query: 425 --CICCRLPIWSSTSSTFPVWICTSVC 499
             C C  + I  S      + IC S+C
Sbjct: 260 IICTCVCICICISMCIYICICICISMC 286


>UniRef50_UPI0000500395 Cluster: UPI0000500395 related cluster; n=1;
           Rattus norvegicus|Rep: UPI0000500395 UniRef100 entry -
           Rattus norvegicus
          Length = 143

 Score = 38.7 bits (86), Expect = 0.11
 Identities = 22/71 (30%), Positives = 29/71 (40%), Gaps = 5/71 (7%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCS--NRCGTSCCPSSGIL---CCFAILCWCCSNPASGSLHSPC 418
           C   CC+   T+ C  CC     C   CC +  +    CC A+  WC       +L   C
Sbjct: 72  CEECCCAL--TMCCEECCCALTECCEECCCALTVWWEECCCALTVWC--EECCCALTVCC 127

Query: 419 SCCICCRLPIW 451
             C CC L +W
Sbjct: 128 EEC-CCTLTVW 137



 Score = 35.5 bits (78), Expect = 1.1
 Identities = 27/91 (29%), Positives = 34/91 (37%), Gaps = 9/91 (9%)
 Frame = +2

Query: 254 CNSICCSYS--C-TLRCTFCCSNR---CGTSCCPSSGILC--CFAILCWCCSNPASGSLH 409
           C   CC+ +  C T+ C  CC      C   CC  + + C  C   L  CC      +L 
Sbjct: 34  CEECCCALTVWCETVWCEECCCALTVWCEECCCALT-VWCEECCCALTMCCEECCC-ALT 91

Query: 410 SPCSCCICCRLPI-WSSTSSTFPVWICTSVC 499
             C  C CC L + W        VW C   C
Sbjct: 92  ECCEEC-CCALTVWWEECCCALTVW-CEECC 120


>UniRef50_Q3UGM7 Cluster: Melanocyte cDNA, RIKEN full-length
           enriched library, clone:G270069C18 product:hypothetical
           Cysteine-rich region profile/Valine-rich region profile
           containing protein, full insert sequence; n=1; Mus
           musculus|Rep: Melanocyte cDNA, RIKEN full-length
           enriched library, clone:G270069C18 product:hypothetical
           Cysteine-rich region profile/Valine-rich region profile
           containing protein, full insert sequence - Mus musculus
           (Mouse)
          Length = 120

 Score = 38.7 bits (86), Expect = 0.11
 Identities = 25/84 (29%), Positives = 34/84 (40%)
 Frame = +2

Query: 248 PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           P+C  +C S  C   C   C + C + C      LC    LC C S   S  +    S C
Sbjct: 19  PVCFVVCVSV-CL--CLSVCISMCVSVCLCECVCLCECVCLCECVSVCLSVCVSVCISVC 75

Query: 428 ICCRLPIWSSTSSTFPVWICTSVC 499
           +C  + +  S S    V +C  VC
Sbjct: 76  VCVTVCVCLSVSLYVCVSVCVCVC 99


>UniRef50_Q55AK6 Cluster: U box domain-containing protein; n=3;
           Eukaryota|Rep: U box domain-containing protein -
           Dictyostelium discoideum AX4
          Length = 1618

 Score = 38.7 bits (86), Expect = 0.11
 Identities = 29/108 (26%), Positives = 54/108 (50%), Gaps = 3/108 (2%)
 Frame = -1

Query: 570 LLSTNKSFVLSLCR---KALCSFSSIEQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECRE 400
           ++S N+S  L+  R   K L + S++   + +I   N  +        +  QQ+Q + ++
Sbjct: 218 IISDNRSSCLNAKRNFEKTLSNDSTVNPLMNEIKKLNETQYNSWRELTKQQQQQQQQQQQ 277

Query: 399 PLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMEL 256
                +Q Q    KQ ++P L QQ+  H  +QQ+ Q++ Q  +QQ +L
Sbjct: 278 QQQQQQQQQQQQQKQKQLPQLPQQQ-KHQPQQQQQQQQQQQQQQQKQL 324


>UniRef50_Q54KL7 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 728

 Score = 38.7 bits (86), Expect = 0.11
 Identities = 22/81 (27%), Positives = 39/81 (48%)
 Frame = -1

Query: 501 EQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEV 322
           + T  QIH     +       +Q  QQ+Q + ++     +Q Q     Q +  L  QQ+ 
Sbjct: 252 QNTQHQIHQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQLQQQQQLQQQQQQ 311

Query: 321 PHLLEQQKVQRRVQL*EQQME 259
             L +QQ++Q++ QL +QQ +
Sbjct: 312 QQLQQQQQLQQQQQLQQQQQQ 332


>UniRef50_Q4UHH6 Cluster: SfiI-subtelomeric related protein family
            member, putative; n=2; Theileria annulata|Rep:
            SfiI-subtelomeric related protein family member, putative
            - Theileria annulata
          Length = 1650

 Score = 38.7 bits (86), Expect = 0.11
 Identities = 20/58 (34%), Positives = 23/58 (39%)
 Frame = +2

Query: 254  CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
            C S CC   C    + C S+ C    C  SG+  C    C CC     GS     SCC
Sbjct: 1515 CESDCCECECECCDSDCFSSDCCDYECFESGLCSCKCCYCQCCDFDCCGS-----SCC 1567


>UniRef50_A0DPF8 Cluster: Chromosome undetermined scaffold_59, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_59,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 1328

 Score = 38.7 bits (86), Expect = 0.11
 Identities = 20/63 (31%), Positives = 37/63 (58%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ+Q + ++ L  L+Q Q    +Q +  L  QQ+     +QQ+ Q++ QL +QQ++
Sbjct: 677 QQQQQQQQQQQKQQLQQLQQQQQQQQQQQKQQLQQQQQQQQQQQQQQQQQQ-QLQQQQLQ 735

Query: 258 LHR 250
            H+
Sbjct: 736 QHQ 738


>UniRef50_O96282 Cluster: Putative uncharacterized protein PFB0950w;
           n=1; Plasmodium falciparum 3D7|Rep: Putative
           uncharacterized protein PFB0950w - Plasmodium falciparum
           (isolate 3D7)
          Length = 307

 Score = 38.3 bits (85), Expect = 0.15
 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%)
 Frame = +2

Query: 269 CSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWC-CSNPASGSLHSPCSCCIC 433
           C+YSC   C   CS+ C   C      +C     C C CS   S      CS C+C
Sbjct: 194 CAYSCLCSCICSCSSLCSCICSCICSCICSCICTCTCICSCLCSCICSCVCS-CVC 248



 Score = 37.1 bits (82), Expect = 0.35
 Identities = 24/71 (33%), Positives = 30/71 (42%), Gaps = 1/71 (1%)
 Frame = +2

Query: 251 LCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWC-CSNPASGSLHSPCSCC 427
           LC+ IC   SC+  C+  CS  C   C       C  + LC C CS   S    S C+C 
Sbjct: 199 LCSCIC---SCSSLCSCICSCICSCICSCICTCTCICSCLCSCICSCVCSCVCSSACTCA 255

Query: 428 ICCRLPIWSST 460
            C    +  ST
Sbjct: 256 -CVYTSVIGST 265


>UniRef50_UPI0000DB6DDB Cluster: PREDICTED: similar to nejire
            CG15319-PB; n=4; Apocrita|Rep: PREDICTED: similar to
            nejire CG15319-PB - Apis mellifera
          Length = 2606

 Score = 37.9 bits (84), Expect = 0.20
 Identities = 25/68 (36%), Positives = 37/68 (54%), Gaps = 3/68 (4%)
 Frame = -1

Query: 456  LDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPL---LGQQEVPHLLEQQKVQRR 286
            L HM S+Q  QQ+Q   ++     +QHQ    +Q RM +   L QQ+     +QQ VQ++
Sbjct: 2338 LQHMMSQQQQQQQQQHQQQQ----QQHQQQQQQQGRMQIQAMLNQQQQQQQQQQQPVQQQ 2393

Query: 285  VQL*EQQM 262
             Q  +QQM
Sbjct: 2394 SQWYKQQM 2401


>UniRef50_UPI0000502DB8 Cluster: UPI0000502DB8 related cluster; n=1;
           Rattus norvegicus|Rep: UPI0000502DB8 UniRef100 entry -
           Rattus norvegicus
          Length = 301

 Score = 37.9 bits (84), Expect = 0.20
 Identities = 21/63 (33%), Positives = 24/63 (38%), Gaps = 5/63 (7%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCP-SSGILCC-FAILCWCCS---NPASGSLHSPC 418
           C   CCS+ C+     CCS +C   CC       CC F     CCS    P   S     
Sbjct: 79  CAPQCCSFQCSPSVPQCCSFQCAPQCCSFQRAPQCCSFQRAPQCCSFQRAPQCCSFQRAP 138

Query: 419 SCC 427
            CC
Sbjct: 139 QCC 141



 Score = 32.3 bits (70), Expect = 10.0
 Identities = 20/63 (31%), Positives = 22/63 (34%), Gaps = 3/63 (4%)
 Frame = +2

Query: 266 CCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCS---NPASGSLHSPCSCCICC 436
           CCS+ C  +C       C   C PS    C F     CCS    P   S      CC   
Sbjct: 74  CCSFQCAPQC-------CSFQCSPSVPQCCSFQCAPQCCSFQRAPQCCSFQRAPQCCSFQ 126

Query: 437 RLP 445
           R P
Sbjct: 127 RAP 129


>UniRef50_UPI0000E24769 Cluster: PREDICTED: keratin associated
           protein 4-13 isoform 1; n=2; Pan troglodytes|Rep:
           PREDICTED: keratin associated protein 4-13 isoform 1 -
           Pan troglodytes
          Length = 156

 Score = 37.5 bits (83), Expect = 0.26
 Identities = 24/70 (34%), Positives = 28/70 (40%), Gaps = 8/70 (11%)
 Frame = +2

Query: 254 CNSICCSYSCTLR--CT-FCCSNRC-GTSCCPSSGILCCFAILC--WCCSNPASGSLHSP 415
           C S+C    C L   C   CC   C  T+CC  S   CC +  C   CC +         
Sbjct: 6   CGSVCSDQGCGLENCCRPSCCQTTCCRTTCCRPS---CCVSSCCRPQCCQSVCCQPTCCS 62

Query: 416 CSCC--ICCR 439
            SCC   CCR
Sbjct: 63  PSCCQTTCCR 72



 Score = 37.5 bits (83), Expect = 0.26
 Identities = 23/77 (29%), Positives = 32/77 (41%), Gaps = 3/77 (3%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC--WCCSNPASGSLHSPCSCC 427
           C + CC  +C  R + C S+ C   CC S   +CC    C   CC      +     SCC
Sbjct: 26  CQTTCCRTTCC-RPSCCVSSCCRPQCCQS---VCCQPTCCSPSCCQTTCCRTTCCHPSCC 81

Query: 428 I-CCRLPIWSSTSSTFP 475
           +  C  P  +S  +  P
Sbjct: 82  VSSCFRPHAASLCAASP 98



 Score = 34.3 bits (75), Expect = 2.5
 Identities = 22/57 (38%), Positives = 25/57 (43%)
 Frame = +2

Query: 227 RPSLLP*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPAS 397
           RP       C   CCS SC  + T C +  C  SCC SS      A LC   S PA+
Sbjct: 47  RPQCCQSVCCQPTCCSPSCC-QTTCCRTTCCHPSCCVSSCFRPHAASLC-AASPPAA 101


>UniRef50_UPI0000D8A01B Cluster: hypothetical protein
           e1012e08.tmp0242; n=1; Eimeria tenella|Rep: hypothetical
           protein e1012e08.tmp0242 - Eimeria tenella
          Length = 140

 Score = 37.5 bits (83), Expect = 0.26
 Identities = 23/78 (29%), Positives = 27/78 (34%), Gaps = 9/78 (11%)
 Frame = +2

Query: 266 CCSYSCTLRCTFCCSNRCGTSCCPSSGILC-CFAILCWCCSNPASGSLH------SP--C 418
           CC  S   RC  CC     T    S    C C    C CC    + + H      SP   
Sbjct: 5   CCCCSAHFRCCCCCCCFADTPALQSCCGRCRCRRCCCCCCGQALAAAAHEQIAAVSPHQA 64

Query: 419 SCCICCRLPIWSSTSSTF 472
            CC CC    W  +  T+
Sbjct: 65  RCCRCCCCCCWRRSLMTY 82


>UniRef50_UPI00006CF21C Cluster: Bowman-Birk serine protease inhibitor
            family protein; n=1; Tetrahymena thermophila SB210|Rep:
            Bowman-Birk serine protease inhibitor family protein -
            Tetrahymena thermophila SB210
          Length = 1467

 Score = 37.5 bits (83), Expect = 0.26
 Identities = 18/60 (30%), Positives = 25/60 (41%)
 Frame = +2

Query: 254  CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCIC 433
            C+S C   S    CT C  NR G +C   SG L     +C  C    +    +  +C +C
Sbjct: 1075 CSSFCAKCSDLQTCTQCNGNRYGNNCSCPSGFLDTQVAVCPACDPRCAECSVTSNNCTVC 1134


>UniRef50_UPI000069F79E Cluster: Mucin-5B precursor (Mucin 5 subtype
           B, tracheobronchial) (High molecular weight salivary
           mucin MG1) (Sublingual gland mucin).; n=1; Xenopus
           tropicalis|Rep: Mucin-5B precursor (Mucin 5 subtype B,
           tracheobronchial) (High molecular weight salivary mucin
           MG1) (Sublingual gland mucin). - Xenopus tropicalis
          Length = 918

 Score = 37.5 bits (83), Expect = 0.26
 Identities = 30/97 (30%), Positives = 36/97 (37%), Gaps = 13/97 (13%)
 Frame = +2

Query: 269 CSYSCTLRCT-----FCCSNRCGTSC-CPSSGIL---CCFAILCWCCSN----PASGSLH 409
           CS  C   C+     F C   C   C CP+  I    C     C C  N    P     H
Sbjct: 274 CSSPCAPTCSNPGRQFFCDGTCVAGCVCPTDDITNSGCVPLKNCSCIFNNDVYPPGSYYH 333

Query: 410 SPCSCCICCRLPIWSSTSSTFPVWICTSVCSIDEKEH 520
           +PCS C+C     W  T    P   C S CS++   H
Sbjct: 334 APCSTCLCTG-SHW--TCENLP---CPSSCSVEGGSH 364


>UniRef50_A2YZM6 Cluster: Putative uncharacterized protein; n=3; Oryza
            sativa|Rep: Putative uncharacterized protein - Oryza
            sativa subsp. indica (Rice)
          Length = 964

 Score = 37.5 bits (83), Expect = 0.26
 Identities = 26/102 (25%), Positives = 50/102 (49%)
 Frame = -1

Query: 504  IEQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQE 325
            ++Q   Q+   N L    H    Q+  Q+Q + ++ L   +  QH   +   +PL  QQ 
Sbjct: 760  LQQQQNQLQQQNQLHQ-QHQLQPQNQLQQQHQLQQQLQQQQLQQHMQLQTQGLPLQQQQS 818

Query: 324  VPHLLEQQKVQRRVQL*EQQMELHRGYGRSEGRCCYQRTQCP 199
              H L+QQ++Q ++Q  +QQ ++ +   + + +   Q+ Q P
Sbjct: 819  QGHPLQQQQMQ-QMQQQQQQQQIQQMQQQQQMQQMQQQQQQP 859


>UniRef50_Q869L1 Cluster: Similar to Dictyostelium discoideum (Slime
           mold). Adenylyl cyclase; n=4; Eukaryota|Rep: Similar to
           Dictyostelium discoideum (Slime mold). Adenylyl cyclase
           - Dictyostelium discoideum (Slime mold)
          Length = 2053

 Score = 37.5 bits (83), Expect = 0.26
 Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 3/67 (4%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQH---RMPLLGQQEVPHLLEQQKVQRRVQ 280
           H   +QH QQ Q   ++     +QHQH   +QH   + P   QQ+ P   + Q+ Q++ Q
Sbjct: 272 HQQHQQHQQQHQQHQQQHQQHQQQHQHQHQQQHQQQQQPQNQQQQQPQNQQMQQQQQQNQ 331

Query: 279 L*EQQME 259
             +QQ +
Sbjct: 332 QMQQQQQ 338



 Score = 33.5 bits (73), Expect = 4.3
 Identities = 15/52 (28%), Positives = 32/52 (61%)
 Frame = -1

Query: 435 QHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQ 280
           Q +Q +Q + ++ L   +QHQ  + +Q +   + QQ++PH  + Q++Q++ Q
Sbjct: 191 QQLQLQQ-QLQQQLQQQQQHQQQLQQQMQHQQMQQQQIPHHQQNQQLQQQQQ 241



 Score = 33.5 bits (73), Expect = 4.3
 Identities = 18/59 (30%), Positives = 32/59 (54%)
 Frame = -1

Query: 435 QHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           Q  QQ Q + ++    L+  Q    +Q +  LL QQ+   L++QQ+ Q++ Q  +QQ +
Sbjct: 361 QQQQQIQQQQQQQQQILQPQQQPQQQQQQQQLLQQQQQQQLMQQQQQQQQQQQQQQQQQ 419



 Score = 32.3 bits (70), Expect = 10.0
 Identities = 19/67 (28%), Positives = 36/67 (53%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*E 271
           H   +QH QQ+Q + ++      Q+Q    +Q +   + QQ+  +   QQ++Q++ QL +
Sbjct: 298 HQHQQQHQQQQQPQNQQQQQ--PQNQQMQQQQQQNQQMQQQQQQNQQMQQQMQQQQQLQQ 355

Query: 270 QQMELHR 250
           QQ  L +
Sbjct: 356 QQQILQQ 362


>UniRef50_Q8IUG1 Cluster: Keratin-associated protein 1-3; n=65;
           Mammalia|Rep: Keratin-associated protein 1-3 - Homo
           sapiens (Human)
          Length = 177

 Score = 37.5 bits (83), Expect = 0.26
 Identities = 28/86 (32%), Positives = 32/86 (37%), Gaps = 4/86 (4%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCW--CCSNPASG--SLHSPCS 421
           C    CS S T   + C  + C TSCC  S   CC    C   CC     G  S  +  +
Sbjct: 9   CGYPSCSTSGTCGSSCCQPSCCETSCCQPS---CCETSCCQPSCCQTSFCGFPSFSTSGT 65

Query: 422 CCICCRLPIWSSTSSTFPVWICTSVC 499
           C   C  P    TS   P    TS C
Sbjct: 66  CSSSCCQPSCCETSCCQPSCCQTSSC 91



 Score = 33.9 bits (74), Expect = 3.3
 Identities = 20/57 (35%), Positives = 25/57 (43%), Gaps = 7/57 (12%)
 Frame = +2

Query: 254 CNSICCSYSC--TLRC---TFCCSNRCGTSCCPSSGILCCFAILCW--CCSNPASGS 403
           C + CC  SC  T  C   +F  S  C +SCC  S   CC    C   CC   + G+
Sbjct: 40  CETSCCQPSCCQTSFCGFPSFSTSGTCSSSCCQPS---CCETSCCQPSCCQTSSCGT 93


>UniRef50_UPI0000DBFA3E Cluster: UPI0000DBFA3E related cluster; n=1;
           Rattus norvegicus|Rep: UPI0000DBFA3E UniRef100 entry -
           Rattus norvegicus
          Length = 207

 Score = 37.1 bits (82), Expect = 0.35
 Identities = 23/84 (27%), Positives = 34/84 (40%), Gaps = 1/84 (1%)
 Frame = +2

Query: 251 LCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSL-HSPCSCC 427
           +C+S+C    C   C  C S  C    C +  ++C     C  C N     + H+ C C 
Sbjct: 61  VCHSVCPCKVCHNVCMVCHSV-CPCKVCHNVCMVCHSVCPCKVCHNVCPCMICHNVCLCL 119

Query: 428 ICCRLPIWSSTSSTFPVWICTSVC 499
             C   +WS T       +C +VC
Sbjct: 120 SQCVPTVWSVTMCAH-CKVCHNVC 142


>UniRef50_Q9W378 Cluster: CG12218-PA; n=2; Drosophila
           melanogaster|Rep: CG12218-PA - Drosophila melanogaster
           (Fruit fly)
          Length = 1189

 Score = 37.1 bits (82), Expect = 0.35
 Identities = 20/65 (30%), Positives = 35/65 (53%)
 Frame = -1

Query: 447 MGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQ 268
           +G  Q +QQ+Q + ++      QHQH + +Q       QQ+   +  QQ+ Q+++QL +Q
Sbjct: 536 LGMTQQLQQQQQQQQQLQQQQHQHQHQVQQQQHHHQQQQQQKQQVQHQQQ-QQKLQLQQQ 594

Query: 267 QMELH 253
           Q   H
Sbjct: 595 QQHQH 599


>UniRef50_Q54WZ1 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 1208

 Score = 37.1 bits (82), Expect = 0.35
 Identities = 21/71 (29%), Positives = 40/71 (56%), Gaps = 2/71 (2%)
 Frame = -1

Query: 465 LEVLDHMGSRQHMQQEQGECREPLAGLEQ--HQHSMAKQHRMPLLGQQEVPHLLEQQKVQ 292
           +++  HM  +Q  QQ+Q + ++ +  ++Q   Q +   Q +  LL QQ+   LL QQ+ Q
Sbjct: 623 IQLFQHMLQQQQAQQQQQQAQQQVQQVQQVQQQQNYYLQQQQALLLQQQQQALLHQQQQQ 682

Query: 291 RRVQL*EQQME 259
           ++ Q+ + Q E
Sbjct: 683 QQQQVEQSQPE 693


>UniRef50_Q54TE3 Cluster: Putative GATA-binding transcription
           factor; n=1; Dictyostelium discoideum AX4|Rep: Putative
           GATA-binding transcription factor - Dictyostelium
           discoideum AX4
          Length = 714

 Score = 37.1 bits (82), Expect = 0.35
 Identities = 19/68 (27%), Positives = 34/68 (50%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*E 271
           H+  +Q  QQ+Q + +      +Q QH   +Q +     QQ+     +QQ+ Q++ Q  +
Sbjct: 338 HLQHQQQHQQQQHQQQHQQQHQQQQQHQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ 397

Query: 270 QQMELHRG 247
           QQ + H G
Sbjct: 398 QQPQYHNG 405



 Score = 35.9 bits (79), Expect = 0.81
 Identities = 29/128 (22%), Positives = 56/128 (43%), Gaps = 9/128 (7%)
 Frame = -1

Query: 504 IEQTLVQIHTGNVLEV---LDHMGSRQH---MQQEQGECREPLAGLEQHQHSMAKQHRMP 343
           I Q  +Q H  ++L++   + H+   Q    M Q+Q + ++     +QH H     H+  
Sbjct: 97  IPQQSIQTHANSILQLNKTMPHVNPPQQNHIMNQQQQQQQQQHYQQQQHPHQQQHPHQQQ 156

Query: 342 LLGQQEVPHLLE---QQKVQRRVQL*EQQMELHRGYGRSEGRCCYQRTQCPAGDINLCSV 172
              QQ+ PH  +   QQ++Q++ Q  +QQ +  +   + + +    + Q P         
Sbjct: 157 HPHQQQHPHQQQHPHQQQIQQQQQQQQQQQQQQQQQQQQQQQQQQPQQQQPQTQSTQERK 216

Query: 171 WRNVLRYS 148
           W  +  YS
Sbjct: 217 WDEIKIYS 224



 Score = 34.3 bits (75), Expect = 2.5
 Identities = 19/64 (29%), Positives = 36/64 (56%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*E 271
           H+G   H+QQ+Q + ++     +QHQ    +Q    L  +Q+   +L+QQ+ Q++ Q  +
Sbjct: 449 HLGPSMHLQQQQ-QNQQNQQIQQQHQQIQHQQQYSQLPIEQQQQMMLQQQQQQQQQQQQQ 507

Query: 270 QQME 259
           QQ +
Sbjct: 508 QQQQ 511


>UniRef50_Q23H30 Cluster: Putative uncharacterized protein; n=1;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 591

 Score = 37.1 bits (82), Expect = 0.35
 Identities = 31/100 (31%), Positives = 50/100 (50%)
 Frame = -1

Query: 579 QYKLLSTNKSFVLSLCRKALCSFSSIEQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECRE 400
           Q KL++TN   +  L +K     + I+Q  +Q    N  ++L    S+Q  +Q+Q   ++
Sbjct: 349 QKKLIATNSKELKELEKKK-SDLNIIKQDTLQALNPNQKDILLRRASQQ-FEQQQSLLKQ 406

Query: 399 PLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQ 280
               L Q Q  + KQH   L+ QQ    LL QQ+  ++VQ
Sbjct: 407 QQQQLIQQQQLLEKQH---LIQQQLQQQLLAQQQQLQQVQ 443


>UniRef50_O77033 Cluster: TRFA; n=2; Dictyostelium discoideum|Rep:
           TRFA - Dictyostelium discoideum (Slime mold)
          Length = 1390

 Score = 37.1 bits (82), Expect = 0.35
 Identities = 19/64 (29%), Positives = 33/64 (51%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*E 271
           H+  +Q  QQ+Q + ++     +QHQ     Q + P   QQ+ P   +QQ  Q++ Q  +
Sbjct: 83  HIQQQQQPQQQQPQQQQSQQQQQQHQQQQQPQQQQPPQQQQQQPPQQQQQPQQQQQQQQQ 142

Query: 270 QQME 259
           QQ +
Sbjct: 143 QQQQ 146


>UniRef50_A0D2J8 Cluster: Chromosome undetermined scaffold_35, whole
           genome shotgun sequence; n=3; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_35,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 527

 Score = 37.1 bits (82), Expect = 0.35
 Identities = 25/75 (33%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = -1

Query: 507 SIEQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSM-AKQHRMPLLGQ 331
           S  Q+  Q    N++++LD   S+   QQ+Q + +  L  L+  Q ++ A+Q + PL+ Q
Sbjct: 278 SQSQSTSQSQQSNLIDILD--ASQNDTQQKQQQQKLNLKQLKIKQPTVQAQQQQQPLVQQ 335

Query: 330 QEVPHLLEQQKVQRR 286
           Q+VP   +QQ+VQ++
Sbjct: 336 QQVPQ--QQQQVQQK 348


>UniRef50_Q9H9U3 Cluster: CDNA FLJ12547 fis, clone NT2RM4000634;
           n=2; Homo sapiens|Rep: CDNA FLJ12547 fis, clone
           NT2RM4000634 - Homo sapiens (Human)
          Length = 307

 Score = 37.1 bits (82), Expect = 0.35
 Identities = 22/86 (25%), Positives = 32/86 (37%), Gaps = 3/86 (3%)
 Frame = +2

Query: 251 LCNSIC---CSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCS 421
           LC   C   C++ C   C + C+  C  +C      +C  A +C C        L     
Sbjct: 143 LCVCACVWGCTFVCVCACVWGCTFVCVCACVCGCTFVCVCACVCGCTF--VCVCLCVWVH 200

Query: 422 CCICCRLPIWSSTSSTFPVWICTSVC 499
            C+C  L +W        VW+   VC
Sbjct: 201 ICVCVCLCVWVHICVCACVWVHICVC 226



 Score = 35.9 bits (79), Expect = 0.81
 Identities = 31/88 (35%), Positives = 35/88 (39%), Gaps = 5/88 (5%)
 Frame = +2

Query: 251 LCNSI-CCSYSCTLRCTFCCSNRCGTSCCPSSGILC-CFAILCWCCSNPASGSLHSPCSC 424
           LC  +  C  +C   CTF C   C   C    G LC C A LC C        L   C C
Sbjct: 92  LCVGVHICVCACVCGCTFVCV--CACVC----GCLCVCGAHLCVCVCLCVGAHL---CVC 142

Query: 425 -CICCRLPIWSST--SSTFPVWICTSVC 499
            C+C    +W  T       VW CT VC
Sbjct: 143 LCVCA--CVWGCTFVCVCACVWGCTFVC 168


>UniRef50_Q0VDU1 Cluster: Krt40 protein; n=1; Mus musculus|Rep:
           Krt40 protein - Mus musculus (Mouse)
          Length = 359

 Score = 36.7 bits (81), Expect = 0.46
 Identities = 23/61 (37%), Positives = 28/61 (45%), Gaps = 5/61 (8%)
 Frame = +2

Query: 266 CCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPA--SGSLHSPC---SCCI 430
           C + S     T C  N C TS C +   L C A L  CC +P   +G  +SPC   SC  
Sbjct: 21  CATASFCPTNTTCLPNTCSTSRCQTPSFL-CRASLPACCLSPCYLAGGCNSPCLVGSCAW 79

Query: 431 C 433
           C
Sbjct: 80  C 80


>UniRef50_Q946W1 Cluster: 50kD gamma zein; n=1; Zea mays|Rep: 50kD
           gamma zein - Zea mays (Maize)
          Length = 295

 Score = 36.7 bits (81), Expect = 0.46
 Identities = 24/77 (31%), Positives = 35/77 (45%), Gaps = 1/77 (1%)
 Frame = -1

Query: 444 GSRQHMQQEQGECREPLAGLEQHQ-HSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQ 268
           G +QH QQ QG  ++     EQHQ  S  +QH+    G  +     + Q+ Q+  Q   Q
Sbjct: 107 GQQQHHQQSQGHVQQHEQSHEQHQGQSHEQQHQQQFQGHDKQQQPQQPQQYQQG-QEKSQ 165

Query: 267 QMELHRGYGRSEGRCCY 217
           Q + H    +   RC Y
Sbjct: 166 QQQCHCQEQQQTTRCSY 182



 Score = 32.3 bits (70), Expect = 10.0
 Identities = 21/71 (29%), Positives = 37/71 (52%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +QH  Q+Q + + P    +Q QH   + H  P   QQ+    ++QQ+ Q + Q  +QQ +
Sbjct: 40  QQHHPQKQ-QHQPPPQHHQQQQHQQQQVHMQPQKHQQQQEVHVQQQQQQPQHQQ-QQQQQ 97

Query: 258 LHRGYGRSEGR 226
            H+   + EG+
Sbjct: 98  QHQQQHQCEGQ 108


>UniRef50_A7ARU3 Cluster: Chromo-helicase DNA-binding protein,
           putative; n=1; Babesia bovis|Rep: Chromo-helicase
           DNA-binding protein, putative - Babesia bovis
          Length = 1729

 Score = 36.7 bits (81), Expect = 0.46
 Identities = 24/82 (29%), Positives = 41/82 (50%), Gaps = 1/82 (1%)
 Frame = -1

Query: 486 QIHTGNVLEVLDHMGSRQHMQQEQ-GECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLL 310
           Q+H  ++++    M  +Q  QQ+Q G  ++P  G +Q Q  M +Q + P +G Q+ PH+ 
Sbjct: 69  QMHPQHMMQ--QQMLQQQMTQQQQMGHVQQPQIGQQQAQQQMPQQAQQP-VGHQQQPHMG 125

Query: 309 EQQKVQRRVQL*EQQMELHRGY 244
            Q + Q   Q  + Q      Y
Sbjct: 126 PQAQTQMPQQQGQSQQPQQMQY 147


>UniRef50_Q6C9A9 Cluster: Similar to sp|P52958 Fusarium solani
           Cutinase transcription factor 1 alpha; n=1; Yarrowia
           lipolytica|Rep: Similar to sp|P52958 Fusarium solani
           Cutinase transcription factor 1 alpha - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 916

 Score = 36.7 bits (81), Expect = 0.46
 Identities = 19/63 (30%), Positives = 34/63 (53%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q M Q Q +  +P  G +QH H+  ++H      QQ+     +QQ+ Q++ Q  +QQ +
Sbjct: 661 QQQMPQAQHQASQPPHGAQQH-HAQQQRHAQQQQQQQQHARQQQQQQQQQQQQHTQQQQQ 719

Query: 258 LHR 250
            H+
Sbjct: 720 THQ 722


>UniRef50_UPI0000DA27B8 Cluster: PREDICTED: similar to TBC1 domain
           family member 2 (Prostate antigen recognized and
           indentified by SEREX) (PARIS-1); n=1; Rattus
           norvegicus|Rep: PREDICTED: similar to TBC1 domain family
           member 2 (Prostate antigen recognized and indentified by
           SEREX) (PARIS-1) - Rattus norvegicus
          Length = 925

 Score = 36.3 bits (80), Expect = 0.61
 Identities = 21/55 (38%), Positives = 29/55 (52%)
 Frame = -2

Query: 455 WTIWVAGSICSRSRESVGSRWQDWSSTSIVWRSSIGCRYWGSKRCRTYWSSKRCS 291
           W+ W +G+ C RS +S    W+ WS T   W + + C   GS RCR + S   CS
Sbjct: 362 WS-W-SGTRCGRS-QSXTRGWRLWSRTVSAWCTRLAC---GSSRCRRFSSMCSCS 410


>UniRef50_Q86JI7 Cluster: Similar to Homo sapiens (Human).
            Myotubularin-related protein 2; n=2; Dictyostelium
            discoideum|Rep: Similar to Homo sapiens (Human).
            Myotubularin-related protein 2 - Dictyostelium discoideum
            (Slime mold)
          Length = 1693

 Score = 36.3 bits (80), Expect = 0.61
 Identities = 19/71 (26%), Positives = 37/71 (52%)
 Frame = -1

Query: 471  NVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQ 292
            N++  ++ M  +Q  QQ Q + ++ L  L+Q Q    +Q +     QQ+     +QQ+ Q
Sbjct: 1602 NIIREIEKMLKQQQQQQLQQQYQQHLQQLQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ 1661

Query: 291  RRVQL*EQQME 259
            ++ Q  +QQ +
Sbjct: 1662 QQQQQQQQQQQ 1672



 Score = 34.3 bits (75), Expect = 2.5
 Identities = 17/67 (25%), Positives = 34/67 (50%)
 Frame = -1

Query: 450  HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*E 271
            H+   Q  QQ+Q + ++     +Q Q    +Q +     QQ+     +QQ+ Q++ Q  +
Sbjct: 1626 HLQQLQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ 1685

Query: 270  QQMELHR 250
            QQ++ H+
Sbjct: 1686 QQLQQHK 1692


>UniRef50_Q54HP2 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 915

 Score = 36.3 bits (80), Expect = 0.61
 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 1/65 (1%)
 Frame = -1

Query: 450 HMGSRQHMQQE-QGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL* 274
           H    QH QQ+ Q + ++    L QH H    QH      QQ+  H  +QQ+ Q++ Q  
Sbjct: 334 HQHQHQHQQQQHQQQAQQQQPHLHQH-HQQQHQHHQYQQQQQQQQHQQQQQQQQQQQQQQ 392

Query: 273 EQQME 259
           +QQ +
Sbjct: 393 QQQQQ 397



 Score = 33.9 bits (74), Expect = 3.3
 Identities = 17/64 (26%), Positives = 31/64 (48%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*E 271
           H    QH Q +Q + ++     +QHQ    +Q +     QQ+     +QQ+ Q++ Q  +
Sbjct: 249 HQQQHQHQQHQQLQLQQQQQQHQQHQQQQHQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ 308

Query: 270 QQME 259
           QQ +
Sbjct: 309 QQQQ 312



 Score = 33.9 bits (74), Expect = 3.3
 Identities = 21/79 (26%), Positives = 37/79 (46%), Gaps = 1/79 (1%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHR-MPLLGQQEVPHLLEQQKVQRRVQL*EQQM 262
           +Q  QQ+Q + ++     +QHQ     QH+      Q +  H  + Q+ Q + Q  +QQ 
Sbjct: 295 QQQQQQQQQQQQQQQQQQQQHQQHQQHQHQHQQHQHQHQHQHQHQHQQQQHQQQAQQQQP 354

Query: 261 ELHRGYGRSEGRCCYQRTQ 205
            LH+ + +      YQ+ Q
Sbjct: 355 HLHQHHQQQHQHHQYQQQQ 373



 Score = 33.1 bits (72), Expect = 5.7
 Identities = 25/102 (24%), Positives = 44/102 (43%)
 Frame = -1

Query: 564 STNKSFVLSLCRKALCSFSSIEQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGL 385
           + + S VL+ C +        +Q   Q       +       +Q  QQ+Q + +      
Sbjct: 191 NVSSSVVLNSCGQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQHHQHHQ 250

Query: 384 EQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +QHQH   +QH+   L QQ+  H   QQ+  ++ Q  +QQ +
Sbjct: 251 QQHQH---QQHQQLQLQQQQQQHQQHQQQQHQQQQQQQQQQQ 289



 Score = 32.7 bits (71), Expect = 7.5
 Identities = 21/82 (25%), Positives = 38/82 (46%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*E 271
           H   +Q  QQ+Q + ++     +QHQH   +Q  + L  QQ+     +QQ+ Q + Q   
Sbjct: 378 HQQQQQQQQQQQQQQQQQQQQQQQHQHQQQQQQLLQLQQQQQQQ---QQQQHQHQHQHQH 434

Query: 270 QQMELHRGYGRSEGRCCYQRTQ 205
           Q    H+   + + +  +Q  Q
Sbjct: 435 QHQHQHQHQHQHQHQHHHQHQQ 456


>UniRef50_Q1JTH9 Cluster: Hyothetical protein; n=4; root|Rep:
           Hyothetical protein - Toxoplasma gondii RH
          Length = 1821

 Score = 36.3 bits (80), Expect = 0.61
 Identities = 27/79 (34%), Positives = 36/79 (45%), Gaps = 6/79 (7%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTF--CCSNRC----GTSCCPSSGILCCFAILCWCCSNPASGSLHSP 415
           C+S  CS S    C+F  C S+ C     +SC  SS   C F+    C S+  SG   S 
Sbjct: 575 CSSSSCSSSSCSGCSFSSCSSSSCSGCSSSSCSSSSWSGCSFSS---CSSSSCSGCSFSS 631

Query: 416 CSCCICCRLPIWSSTSSTF 472
           CS   C      S +SS++
Sbjct: 632 CSSSSCSGCSSSSCSSSSW 650



 Score = 34.7 bits (76), Expect = 1.9
 Identities = 26/83 (31%), Positives = 34/83 (40%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCIC 433
           C+S  CS   +  C+    + C  S C SS   C       C S+  SG   S CS   C
Sbjct: 632 CSSSSCSGCSSSSCSSSSWSGCSFSSCSSSS--CSGCSFSSCSSSSCSGCSSSSCSSSSC 689

Query: 434 CRLPIWSSTSSTFPVWICTSVCS 502
                +SS SS+      +S CS
Sbjct: 690 SGCS-FSSCSSSSCSGCSSSSCS 711



 Score = 34.7 bits (76), Expect = 1.9
 Identities = 25/76 (32%), Positives = 32/76 (42%), Gaps = 3/76 (3%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTF--CCSNRC-GTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSC 424
           C+S  CS S    C+F  C S+ C G S    S   C       C S+  SG   S CS 
Sbjct: 640 CSSSSCSSSSWSGCSFSSCSSSSCSGCSFSSCSSSSCSGCSSSSCSSSSCSGCSFSSCSS 699

Query: 425 CICCRLPIWSSTSSTF 472
             C      S +SS++
Sbjct: 700 SSCSGCSSSSCSSSSW 715



 Score = 34.7 bits (76), Expect = 1.9
 Identities = 20/58 (34%), Positives = 27/58 (46%), Gaps = 3/58 (5%)
 Frame = +2

Query: 269 CSYS-CTLR-CTFCCSNRCGTSCCPSSGILCCFAILC-WCCSNPASGSLHSPCSCCIC 433
           CS+S C+   C+ C S+ C +S C       C +  C  C S+  S S  S CS   C
Sbjct: 666 CSFSSCSSSSCSGCSSSSCSSSSCSGCSFSSCSSSSCSGCSSSSCSSSSWSGCSFSSC 723



 Score = 33.9 bits (74), Expect = 3.3
 Identities = 28/91 (30%), Positives = 37/91 (40%), Gaps = 8/91 (8%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTF--CCSNRCGTSCCPSSGILCCFAILCWCCSNPA------SGSLH 409
           C    CS S    C+F  C S+ C +S C       C +  C  CS+ +      SG   
Sbjct: 557 CLFSSCSSSSWSGCSFSSCSSSSCSSSSCSGCSFSSCSSSSCSGCSSSSCSSSSWSGCSF 616

Query: 410 SPCSCCICCRLPIWSSTSSTFPVWICTSVCS 502
           S CS   C     +SS SS+      +S CS
Sbjct: 617 SSCSSSSCSGCS-FSSCSSSSCSGCSSSSCS 646



 Score = 33.5 bits (73), Expect = 4.3
 Identities = 26/78 (33%), Positives = 34/78 (43%), Gaps = 6/78 (7%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTF--CCSNRC----GTSCCPSSGILCCFAILCWCCSNPASGSLHSP 415
           C+   CS S    C+F  C S+ C     +SC  SS   C F+    C S+  SG   S 
Sbjct: 614 CSFSSCSSSSCSGCSFSSCSSSSCSGCSSSSCSSSSWSGCSFSS---CSSSSCSGCSFSS 670

Query: 416 CSCCICCRLPIWSSTSST 469
           CS   C      S +SS+
Sbjct: 671 CSSSSCSGCSSSSCSSSS 688



 Score = 33.1 bits (72), Expect = 5.7
 Identities = 30/88 (34%), Positives = 38/88 (43%), Gaps = 5/88 (5%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFC-CSNR----CGTSCCPSSGILCCFAILCWCCSNPASGSLHSPC 418
           C+S  CS S    C+F  CS+     C  S C SS    C +    C S+  SG   S C
Sbjct: 601 CSSSSCSSSSWSGCSFSSCSSSSCSGCSFSSCSSSSCSGCSS--SSCSSSSWSGCSFSSC 658

Query: 419 SCCICCRLPIWSSTSSTFPVWICTSVCS 502
           S   C     +SS SS+      +S CS
Sbjct: 659 SSSSCSGCS-FSSCSSSSCSGCSSSSCS 685



 Score = 32.7 bits (71), Expect = 7.5
 Identities = 25/83 (30%), Positives = 34/83 (40%), Gaps = 4/83 (4%)
 Frame = +2

Query: 269 CSYS-CTLR-CTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC--ICC 436
           CS+S C+   C+ C  + C +S C       C +  C  CS  +  S  S CS C    C
Sbjct: 653 CSFSSCSSSSCSGCSFSSCSSSSCSGCSSSSCSSSSCSGCSFSSCSS--SSCSGCSSSSC 710

Query: 437 RLPIWSSTSSTFPVWICTSVCSI 505
               WS  S +       S CS+
Sbjct: 711 SSSSWSGCSFSSCSSSSCSTCSL 733


>UniRef50_A0C1S7 Cluster: Chromosome undetermined scaffold_142, whole
            genome shotgun sequence; n=8; Paramecium|Rep: Chromosome
            undetermined scaffold_142, whole genome shotgun sequence
            - Paramecium tetraurelia
          Length = 2671

 Score = 36.3 bits (80), Expect = 0.61
 Identities = 22/89 (24%), Positives = 35/89 (39%), Gaps = 1/89 (1%)
 Frame = +2

Query: 254  CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCIC 433
            C++  C+   +      C N  GT+ C  +G   C+A L  C S     S     + C  
Sbjct: 874  CSARACNLWVSTLTNITCDNYNGTASCKLNGASYCYAPLASCASYTIPNSTTDKLAWCNA 933

Query: 434  CRLPIWSSTSSTFPVWICTSVCS-IDEKE 517
                  + T  ++   + T+ CS ID  E
Sbjct: 934  MFTNAATPTKCSYDAGVSTTACSNIDSCE 962


>UniRef50_A3LQZ7 Cluster: ROX1-like HMG-box transcription factor;
           n=1; Pichia stipitis|Rep: ROX1-like HMG-box
           transcription factor - Pichia stipitis (Yeast)
          Length = 517

 Score = 36.3 bits (80), Expect = 0.61
 Identities = 23/88 (26%), Positives = 45/88 (51%), Gaps = 2/88 (2%)
 Frame = -1

Query: 519 CSFSSIEQTLVQIHTGNVLEVLDHMGSR--QHMQQEQGECREPLAGLEQHQHSMAKQHRM 346
           C   ++ Q  VQ+H   +L++      +  Q  QQ+Q + +  ++  +Q QH M++Q   
Sbjct: 260 CRQKAMRQQQVQLHNQQMLQIQQEQYQQYLQLQQQQQQQQQHIMSQQQQQQHIMSQQQ-- 317

Query: 345 PLLGQQEVPHLLEQQKVQRRVQL*EQQM 262
               QQ+  H++ QQ+ Q + Q  +Q +
Sbjct: 318 ----QQQQQHIIGQQQQQSQQQQQQQNL 341


>UniRef50_Q9BYP8 Cluster: Keratin-associated protein 17-1; n=28;
           Coelomata|Rep: Keratin-associated protein 17-1 - Homo
           sapiens (Human)
          Length = 105

 Score = 36.3 bits (80), Expect = 0.61
 Identities = 23/71 (32%), Positives = 25/71 (35%), Gaps = 10/71 (14%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCS--------NRCGTSCCPSSGILCCFAIL--CWCCSNPASGS 403
           C   CC   C   C  CC         + CG SCC SS   CC +    C  C     G 
Sbjct: 19  CEECCCQPGCCGCCGSCCGCGGSGCGGSGCGGSCCGSS---CCGSGCGGCGGCGGCGGGC 75

Query: 404 LHSPCSCCICC 436
             S C    CC
Sbjct: 76  CGSSCCGSSCC 86


>UniRef50_UPI0001553745 Cluster: PREDICTED: similar to Keratin
           associated protein 10-4; n=2; Mus musculus|Rep:
           PREDICTED: similar to Keratin associated protein 10-4 -
           Mus musculus
          Length = 654

 Score = 35.9 bits (79), Expect = 0.81
 Identities = 24/84 (28%), Positives = 33/84 (39%), Gaps = 6/84 (7%)
 Frame = +2

Query: 254 CNSICCSY--SCTLRCTFCCSNRCGTSC--CPSSGILCCFAILCWCC-SNPASGSLHSPC 418
           C    C Y  S  +   F C+      C   P      C  I+C CC S P         
Sbjct: 389 CAVTVCLYCQSVPVLSEFACAVTVCLYCHSVPVLSQCACTVIVCLCCHSVPVLSQCACAV 448

Query: 419 SCCICCR-LPIWSSTSSTFPVWIC 487
           + C+CCR +P+ S  + T  V +C
Sbjct: 449 TVCLCCRSVPVLSQCACTVTVCLC 472



 Score = 33.5 bits (73), Expect = 4.3
 Identities = 26/88 (29%), Positives = 41/88 (46%), Gaps = 18/88 (20%)
 Frame = +2

Query: 278 SCTLRCTFCCS-----NRCGTS-----CCPSSGIL--CCFAI-LCWCCSNPASGSLHSPC 418
           +CT+R   CC      + C  +     CC S  +L  C  A+ +C CC    S  + S C
Sbjct: 160 ACTVRVCLCCQSVPVLSECACAVTVCLCCQSVPVLSQCACAVRVCLCCQ---SVPVLSQC 216

Query: 419 SC----CICCR-LPIWSSTSSTFPVWIC 487
           +C    C+ C+ +P+ S  + T  V +C
Sbjct: 217 ACAVRVCLYCQSVPVLSQCACTVTVCLC 244


>UniRef50_UPI0000F1D903 Cluster: PREDICTED: hypothetical protein; n=2;
            Danio rerio|Rep: PREDICTED: hypothetical protein - Danio
            rerio
          Length = 1762

 Score = 35.9 bits (79), Expect = 0.81
 Identities = 22/67 (32%), Positives = 37/67 (55%), Gaps = 3/67 (4%)
 Frame = -1

Query: 456  LDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPL---LGQQEVPHLLEQQKVQRR 286
            L H+  RQ  ++ Q  C E     ++ Q ++ KQ R  L   L QQ+  H L +Q +QR+
Sbjct: 1538 LRHILHRQEQERLQRLCLEEEKQRQEQQRALEKQRRELLQLQLQQQQQEHRLRRQLLQRQ 1597

Query: 285  VQL*EQQ 265
            +++ +QQ
Sbjct: 1598 LEMEQQQ 1604


>UniRef50_UPI0000DA48D4 Cluster: PREDICTED: hypothetical protein;
           n=1; Rattus norvegicus|Rep: PREDICTED: hypothetical
           protein - Rattus norvegicus
          Length = 240

 Score = 35.9 bits (79), Expect = 0.81
 Identities = 28/85 (32%), Positives = 36/85 (42%), Gaps = 13/85 (15%)
 Frame = +2

Query: 239 LP*PLCNSIC--CSYSCTLRCTFCCSNRCGTSC--------CPSSGILCCFAILCWCCSN 388
           +P  LC+  C  C  SC L  T  C+ +C  SC        CP S + C    LC  C  
Sbjct: 17  VPTVLCSLSCDHCPVSCVL--TVLCA-QCPVSCVLTVLCAHCPVSSLSCILTFLCAHC-- 71

Query: 389 PASGSLHSPCSC---CICCRLPIWS 454
           P +  L    SC    +C   P+WS
Sbjct: 72  PYAHCLVCSLSCVLTVLCAHCPVWS 96


>UniRef50_Q3TLG6 Cluster: Mammary gland RCB-0527 Jyg-MC(B) cDNA,
           RIKEN full-length enriched library, clone:G930050F03
           product:positive cofactor 2, multiprotein complex,
           glutamine/Q-rich-associated protein, full insert
           sequence; n=13; Tetrapoda|Rep: Mammary gland RCB-0527
           Jyg-MC(B) cDNA, RIKEN full-length enriched library,
           clone:G930050F03 product:positive cofactor 2,
           multiprotein complex, glutamine/Q-rich-associated
           protein, full insert sequence - Mus musculus (Mouse)
          Length = 639

 Score = 35.9 bits (79), Expect = 0.81
 Identities = 24/97 (24%), Positives = 42/97 (43%)
 Frame = -1

Query: 543 LSLCRKALCSFSSIEQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSM 364
           LSL  + +  F  I     Q      L++      +Q  QQ+Q + ++  A L+Q Q   
Sbjct: 60  LSLVARLIIHFRDIHNKKSQASVSAQLQLQQVALQQQQQQQQQQQFQQQQAALQQQQQQQ 119

Query: 363 AKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELH 253
            +Q +      Q+     + Q V ++ QL +QQ + H
Sbjct: 120 QQQQQQQQFQAQQNAMQQQFQAVVQQQQLQQQQQQQH 156


>UniRef50_Q0VC31 Cluster: Keratin associated protein-like; n=5;
           Eutheria|Rep: Keratin associated protein-like - Bos
           taurus (Bovine)
          Length = 132

 Score = 35.9 bits (79), Expect = 0.81
 Identities = 24/80 (30%), Positives = 32/80 (40%)
 Frame = +2

Query: 248 PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           P    +CC   C+L+   CC      +CCP+S         CW  +     S+ SPC   
Sbjct: 57  PCRRPVCCD-PCSLQ-EGCCRP---ITCCPTSCQAVVCRPCCWATTCCQPISVQSPCCRP 111

Query: 428 ICCRLPIWSSTSSTFPVWIC 487
            CCR     +T  TF    C
Sbjct: 112 TCCRPAPCRTTCRTFRTSPC 131


>UniRef50_Q9Y1T3 Cluster: Metallothionein-like protein; n=1; Jasus
           edwardsii|Rep: Metallothionein-like protein - Jasus
           edwardsii (red rock lobster)
          Length = 141

 Score = 35.9 bits (79), Expect = 0.81
 Identities = 23/67 (34%), Positives = 28/67 (41%), Gaps = 10/67 (14%)
 Frame = +2

Query: 263 ICCSYSCTLRCT----FCCSNRCGTS-CCPSSGILCCFAILCWCCSNPASGSLHSPC--- 418
           +CCS S  + C+     CCS  C    CC  S  +CC   +  CCS        S C   
Sbjct: 61  VCCSCSVDVCCSCSVDVCCS--CSVDVCCSCSVDVCCSCSVDVCCSCSVDVCCRSCCLEV 118

Query: 419 --SCCIC 433
              CCIC
Sbjct: 119 SMLCCIC 125



 Score = 34.7 bits (76), Expect = 1.9
 Identities = 21/59 (35%), Positives = 27/59 (45%), Gaps = 1/59 (1%)
 Frame = +2

Query: 263 ICCSYSCTLRCTFCCSNRCGTS-CCPSSGILCCFAILCWCCSNPASGSLHSPCSCCICC 436
           +CCS S  +    CCS  C    CC  S  +CC   +  CCS   S  +   CS  +CC
Sbjct: 53  VCCSCSVDV----CCS--CSVDVCCSCSVDVCCSCSVDVCCS--CSVDVCCSCSVDVCC 103



 Score = 34.3 bits (75), Expect = 2.5
 Identities = 14/35 (40%), Positives = 19/35 (54%)
 Frame = +2

Query: 263 ICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAI 367
           +CCS S  + C+ C  + C  SCC    +LCC  I
Sbjct: 93  VCCSCSVDVCCS-CSVDVCCRSCCLEVSMLCCICI 126


>UniRef50_Q9VVJ8 Cluster: CG6064-PA; n=1; Drosophila
           melanogaster|Rep: CG6064-PA - Drosophila melanogaster
           (Fruit fly)
          Length = 797

 Score = 35.9 bits (79), Expect = 0.81
 Identities = 28/100 (28%), Positives = 51/100 (51%), Gaps = 3/100 (3%)
 Frame = -1

Query: 540 SLCRKALCSFSSIEQTLVQIHTGNVLEVLDHMGSRQHMQQEQ-GECRE--PLAGLEQHQH 370
           SL R++    +  +  LV     +V  +  +   +QH QQ+Q G+ R   P  G+ +   
Sbjct: 150 SLWRRSSSDSALHQSALVAGFNSDVNSMGANYQQQQHQQQQQPGQPRSHSPHHGINRTMS 209

Query: 369 SMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELHR 250
             A++ + PLL     PH L+ Q++Q++ Q  + Q +LH+
Sbjct: 210 PQAQRRKSPLLQ----PHQLQLQQLQQQQQQMQHQHQLHQ 245


>UniRef50_Q86AM9 Cluster: Similar to Dictyostelium discoideum (Slime
           mold). Adenylyl cyclase; n=2; Dictyostelium
           discoideum|Rep: Similar to Dictyostelium discoideum
           (Slime mold). Adenylyl cyclase - Dictyostelium
           discoideum (Slime mold)
          Length = 680

 Score = 35.9 bits (79), Expect = 0.81
 Identities = 22/84 (26%), Positives = 40/84 (47%)
 Frame = -1

Query: 501 EQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEV 322
           +Q L+Q H  +V +    +  +Q + Q Q    +      Q QH   +QH+     QQ+ 
Sbjct: 461 KQQLIQHHQQSVNQ--QQLAQQQQLAQHQQYNSQQHQQHHQQQHQQHQQHQQQQQQQQQQ 518

Query: 321 PHLLEQQKVQRRVQL*EQQMELHR 250
               +QQ+ Q++ Q  +QQ + H+
Sbjct: 519 QQQQQQQQQQQQQQQQQQQQQYHQ 542


>UniRef50_Q6NKN1 Cluster: RE66582p; n=4; Diptera|Rep: RE66582p -
           Drosophila melanogaster (Fruit fly)
          Length = 1057

 Score = 35.9 bits (79), Expect = 0.81
 Identities = 17/66 (25%), Positives = 31/66 (46%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +QH QQ+Q + ++    +  HQH      +     Q +  H  +Q + Q++ Q  +QQ +
Sbjct: 65  QQHQQQQQQQQQQHQQNMHHHQHQQQHMQQQQQQQQHQQQHQQQQHQQQQQHQQQQQQQQ 124

Query: 258 LHRGYG 241
            H   G
Sbjct: 125 QHPTIG 130


>UniRef50_Q55G20 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 712

 Score = 35.9 bits (79), Expect = 0.81
 Identities = 29/80 (36%), Positives = 40/80 (50%), Gaps = 1/80 (1%)
 Frame = -1

Query: 501 EQTLVQIHTGNVLEVLD-HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQE 325
           +Q L Q+H  N +E+   H    Q  QQ Q E +  L   +Q+QH   KQ     L QQ 
Sbjct: 299 QQQLQQLHQQNQIEIQRYHQRQLQQQQQIQIEQQRQLLVQQQNQHQQ-KQIEYQKLQQQH 357

Query: 324 VPHLLEQQKVQRRVQL*EQQ 265
           +  LL QQ+ Q++ Q   QQ
Sbjct: 358 L--LLHQQQQQQQQQPQHQQ 375



 Score = 35.1 bits (77), Expect = 1.4
 Identities = 19/61 (31%), Positives = 34/61 (55%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ+Q + ++     +Q Q    +Q +     QQ+VP   +QQ+ Q+++Q  +QQ E
Sbjct: 524 QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQYQQQVPQQQQQQQYQQQIQ--QQQEE 581

Query: 258 L 256
           L
Sbjct: 582 L 582


>UniRef50_Q55FL7 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 1034

 Score = 35.9 bits (79), Expect = 0.81
 Identities = 19/63 (30%), Positives = 35/63 (55%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +QH QQ+  + ++     +QHQ    +Q + P   QQ+ P   +QQ+ Q++ Q  +QQ +
Sbjct: 694 QQHQQQQPQQHQQQQQPQQQHQPQ--QQQQQPQQQQQQQPQQQQQQQQQQQQQQQQQQQQ 751

Query: 258 LHR 250
            H+
Sbjct: 752 QHQ 754



 Score = 32.7 bits (71), Expect = 7.5
 Identities = 18/60 (30%), Positives = 32/60 (53%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ+Q + ++ L  L+Q QH    Q + P   QQ+ P   +QQ+  ++    +QQ +
Sbjct: 663 QQQQQQQQQQQQQQLQQLQQ-QHQQQPQQQQPQQHQQQQPQQHQQQQQPQQQHQPQQQQQ 721


>UniRef50_Q4MYQ6 Cluster: Putative uncharacterized protein; n=4;
           Theileria parva|Rep: Putative uncharacterized protein -
           Theileria parva
          Length = 1796

 Score = 35.9 bits (79), Expect = 0.81
 Identities = 25/69 (36%), Positives = 28/69 (40%), Gaps = 7/69 (10%)
 Frame = +2

Query: 251 LCN---SICCSYSCTLRCTFCCSNRCGTSCCPSSGILC-CFAILCWCCSN-PASGSLHS- 412
           LCN   S CCS      CT C  ++     CPSS   C C       C+     G  HS 
Sbjct: 778 LCNCDKSKCCSSDGNNNCTCCNGDKVKCCLCPSSKSECKCSCKSGNTCNELCCRGQSHSG 837

Query: 413 -PCSCCICC 436
             C CC CC
Sbjct: 838 NNCVCCRCC 846


>UniRef50_Q8NH31 Cluster: Seven transmembrane helix receptor; n=1;
           Homo sapiens|Rep: Seven transmembrane helix receptor -
           Homo sapiens (Human)
          Length = 346

 Score = 35.9 bits (79), Expect = 0.81
 Identities = 24/89 (26%), Positives = 36/89 (40%), Gaps = 7/89 (7%)
 Frame = +2

Query: 251 LCNSIC-----CSYSCTLRCT--FCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLH 409
           +C S+C     C Y C   C   +   + C       S  LC +  +C C S     S+ 
Sbjct: 77  VCVSVCVYVSVCMYLCVFLCVCVYVSVSVCLCVYLHISVYLCVYVCICVCVSVSLCVSVC 136

Query: 410 SPCSCCICCRLPIWSSTSSTFPVWICTSV 496
           +  S C+C R+ +  S      V +C SV
Sbjct: 137 ACLSLCVCIRVSVCLSLRVCVCVCLCVSV 165


>UniRef50_Q5T750 Cluster: Uncharacterized protein C1orf68; n=6;
           Euarchontoglires|Rep: Uncharacterized protein C1orf68 -
           Homo sapiens (Human)
          Length = 250

 Score = 35.9 bits (79), Expect = 0.81
 Identities = 22/57 (38%), Positives = 25/57 (43%), Gaps = 1/57 (1%)
 Frame = +2

Query: 257 NSICCSYSCTLRCTFCCSNRCGTSC-CPSSGILCCFAILCWCCSNPASGSLHSPCSC 424
           +S CC  S +  C  C S  CG SC C SSG  CC  I+      PA       C C
Sbjct: 197 SSGCCENSGSSGC--CGSGGCGCSCGCGSSG-CCCLGIIPMRSRGPACCDHEDDCCC 250


>UniRef50_Q750L9 Cluster: AGL062Cp; n=1; Eremothecium gossypii|Rep:
           AGL062Cp - Ashbya gossypii (Yeast) (Eremothecium
           gossypii)
          Length = 1110

 Score = 35.9 bits (79), Expect = 0.81
 Identities = 21/79 (26%), Positives = 40/79 (50%)
 Frame = -1

Query: 441 SRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQM 262
           S+QH QQ+Q + ++ L    Q  H    Q +   L QQ+   L +QQ+ Q++ Q  +Q  
Sbjct: 400 SQQHQQQQQQQLQQQLQPQPQPHHHHHHQQQKQQLQQQQQQQLQQQQQQQQQNQQHQQHQ 459

Query: 261 ELHRGYGRSEGRCCYQRTQ 205
           + ++ +   + +   Q+ Q
Sbjct: 460 QQNQQHQHQQQQQHQQQQQ 478



 Score = 33.9 bits (74), Expect = 3.3
 Identities = 19/89 (21%), Positives = 45/89 (50%), Gaps = 5/89 (5%)
 Frame = -1

Query: 510 SSIEQTLVQIHTGNVLEVLDHMGSR-----QHMQQEQGECREPLAGLEQHQHSMAKQHRM 346
           ++++Q  +  + GN + ++  +  +     Q  QQ+Q + ++     +QHQ    +QH+ 
Sbjct: 256 NNLKQQAISKNNGNAVAMITQLQQQVQMSIQQKQQQQQQHQQQQQQQQQHQQQQNQQHQQ 315

Query: 345 PLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
               QQ+     +Q ++Q++ Q  +QQ +
Sbjct: 316 QQHQQQQHQQQHQQNQLQQKQQQQQQQQQ 344


>UniRef50_Q4PF35 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 1195

 Score = 35.9 bits (79), Expect = 0.81
 Identities = 18/61 (29%), Positives = 32/61 (52%)
 Frame = -1

Query: 441 SRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQM 262
           S+QH QQ+Q   +  L   +QH   + +Q  +    QQ+     +QQ+ Q++ Q  +QQ 
Sbjct: 134 SQQHPQQQQQHLQHHLGAQQQHHVQLQQQQHLQQQQQQQQQQQQQQQQQQQQQQQQQQQQ 193

Query: 261 E 259
           +
Sbjct: 194 Q 194



 Score = 32.3 bits (70), Expect = 10.0
 Identities = 27/107 (25%), Positives = 49/107 (45%)
 Frame = -1

Query: 504 IEQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQE 325
           ++Q  +Q+      + L H+   Q  QQ Q   ++    L QH     +QH + L  QQ 
Sbjct: 106 LQQPQLQLQHPQHPQHLQHLHHSQLQQQSQQHPQQQQQHL-QHHLGAQQQHHVQLQQQQH 164

Query: 324 VPHLLEQQKVQRRVQL*EQQMELHRGYGRSEGRCCYQRTQCPAGDIN 184
           +    +QQ+ Q++ Q  +QQ +  +   + + +   Q+ Q PA   N
Sbjct: 165 LQQ--QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQGQQPAPQPN 209


>UniRef50_A7TH70 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 268

 Score = 35.9 bits (79), Expect = 0.81
 Identities = 24/78 (30%), Positives = 40/78 (51%)
 Frame = -1

Query: 426 QQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELHRG 247
           QQ+Q + + P AG +Q Q  + +Q     +GQQ+    + QQ+ Q  V   +QQ +   G
Sbjct: 151 QQQQQQAQAP-AGQQQAQAPVGQQQAQAPVGQQQAQAPVGQQQAQAPVG--QQQAQAPVG 207

Query: 246 YGRSEGRCCYQRTQCPAG 193
             +++     Q+ Q PAG
Sbjct: 208 QQQAQAPVGQQQAQAPAG 225


>UniRef50_A6ZL00 Cluster: Conserved protein; n=1; Saccharomyces
           cerevisiae YJM789|Rep: Conserved protein - Saccharomyces
           cerevisiae YJM789
          Length = 66

 Score = 35.9 bits (79), Expect = 0.81
 Identities = 11/28 (39%), Positives = 15/28 (53%)
 Frame = +2

Query: 302 CCSNRCGTSCCPSSGILCCFAILCWCCS 385
           CC   CG  C   + +LCC  ++  CCS
Sbjct: 34  CCCCNCGDCCSAIANVLCCLCLIDLCCS 61


>UniRef50_Q469Q0 Cluster: Putative uncharacterized protein; n=1;
           Methanosarcina barkeri str. Fusaro|Rep: Putative
           uncharacterized protein - Methanosarcina barkeri (strain
           Fusaro / DSM 804)
          Length = 277

 Score = 35.9 bits (79), Expect = 0.81
 Identities = 20/67 (29%), Positives = 26/67 (38%), Gaps = 6/67 (8%)
 Frame = +2

Query: 254 CNSIC---CSYSCTLRCTFCCS-NRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPC- 418
           C  +C   C   C   CT  C+ + C  +CC     +C       CC N A     S C 
Sbjct: 134 CADVCSQDCKGECCDNCTENCNGSECAGNCCDECADVCSQDCKGECCDNCAENCNESECA 193

Query: 419 -SCCICC 436
            +CC  C
Sbjct: 194 GNCCDEC 200



 Score = 33.5 bits (73), Expect = 4.3
 Identities = 19/67 (28%), Positives = 25/67 (37%), Gaps = 6/67 (8%)
 Frame = +2

Query: 254 CNSIC---CSYSCTLRCTFCCS-NRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPC- 418
           C  +C   C   C   CT  C+ + C  +CC     +C       CC N       S C 
Sbjct: 101 CADVCGQDCKGECCDNCTENCNGSECAGNCCDECADVCSQDCKGECCDNCTENCNGSECA 160

Query: 419 -SCCICC 436
            +CC  C
Sbjct: 161 GNCCDEC 167


>UniRef50_Q93074 Cluster: Mediator of RNA polymerase II transcription
            subunit 12; n=46; Euteleostomi|Rep: Mediator of RNA
            polymerase II transcription subunit 12 - Homo sapiens
            (Human)
          Length = 2212

 Score = 35.9 bits (79), Expect = 0.81
 Identities = 17/63 (26%), Positives = 36/63 (57%)
 Frame = -1

Query: 438  RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
            +Q  QQ+Q + ++     +Q Q+ + +Q +  +L QQ+     +QQ+ Q++ Q  +QQ +
Sbjct: 2090 QQQQQQQQQQQQQQQQQQQQQQYHIRQQQQQQILRQQQQQQQQQQQQQQQQQQQQQQQQQ 2149

Query: 258  LHR 250
             H+
Sbjct: 2150 QHQ 2152


>UniRef50_Q75NZ4 Cluster: Low-CO2 inducible protein LCI6; n=1;
           Chlamydomonas reinhardtii|Rep: Low-CO2 inducible protein
           LCI6 - Chlamydomonas reinhardtii
          Length = 444

 Score = 35.5 bits (78), Expect = 1.1
 Identities = 25/78 (32%), Positives = 37/78 (47%), Gaps = 1/78 (1%)
 Frame = -2

Query: 488 CKSIRGTY*RCWTIWVAGSICSRSRESVGSRWQDWSSTSIVWRSSIGCRYWGSKRCRTYW 309
           C+S   T  RCWT+  A    S++R +  S W   +S S + R + G R   S+ C   W
Sbjct: 363 CRSTCATALRCWTVTCAVGTRSQARLAPCSSWLATASWSPL-RRATGAR---SRCCAQIW 418

Query: 308 SSKRCSVGCSYRS-SKWS 258
           +   C+     RS S W+
Sbjct: 419 TCASCAGSALVRSRSTWA 436


>UniRef50_Q556G5 Cluster: Putative uncharacterized protein; n=2;
           Dictyostelium discoideum|Rep: Putative uncharacterized
           protein - Dictyostelium discoideum AX4
          Length = 1203

 Score = 35.5 bits (78), Expect = 1.1
 Identities = 19/60 (31%), Positives = 34/60 (56%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ+Q + ++ L  L+Q Q  + +Q +     QQ+     +QQ+ Q++ Q  EQQ+E
Sbjct: 232 QQQQQQQQQQLQQQLQQLQQLQQLLLQQQQQQQQQQQQQQQQQQQQQQQQQQQQIEQQIE 291


>UniRef50_Q54DK4 Cluster: Putative uncharacterized protein ak1; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein ak1 - Dictyostelium discoideum
           AX4
          Length = 1352

 Score = 35.5 bits (78), Expect = 1.1
 Identities = 19/77 (24%), Positives = 41/77 (53%)
 Frame = -1

Query: 489 VQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLL 310
           +Q+++ N+ +    M  +Q  QQ+Q + ++     +Q Q    +Q +M    QQ++    
Sbjct: 674 LQLNSNNIRQHPQQMYIQQQQQQQQQQQQQQQQQQQQQQQQQQQQLQMQQQQQQQMQQHY 733

Query: 309 EQQKVQRRVQL*EQQME 259
           +QQ+ Q++ Q  +QQ +
Sbjct: 734 QQQQQQQQQQQQQQQQQ 750


>UniRef50_Q2VJJ7 Cluster: Tes118; n=6; mojavensis species
           complex|Rep: Tes118 - Drosophila arizonae (Fruit fly)
          Length = 189

 Score = 35.5 bits (78), Expect = 1.1
 Identities = 15/30 (50%), Positives = 17/30 (56%), Gaps = 3/30 (10%)
 Frame = +2

Query: 257 NSICCSYSCTLRCTFCCSNRCGTS---CCP 337
           NS CCS  C+  C+  CSN C  S   CCP
Sbjct: 20  NSCCCSNGCSNGCSNGCSNGCSNSAGACCP 49


>UniRef50_Q19KF6 Cluster: Metallothionein; n=1; Orchesella
           villosa|Rep: Metallothionein - Orchesella villosa
          Length = 61

 Score = 35.5 bits (78), Expect = 1.1
 Identities = 17/55 (30%), Positives = 19/55 (34%)
 Frame = +2

Query: 272 SYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCICC 436
           S S  +R   CC + C           CC A    CC      S     SCC CC
Sbjct: 7   SASDAIRNCVCCGDNCKCGGAEGKSPACCKAKN--CCKGAGQASQSQTASCCTCC 59


>UniRef50_A0BRR4 Cluster: Chromosome undetermined scaffold_123,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_123,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 379

 Score = 35.5 bits (78), Expect = 1.1
 Identities = 18/57 (31%), Positives = 32/57 (56%)
 Frame = -1

Query: 429 MQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +QQ+Q + ++ L   +Q   S  KQ +     QQ+    L+QQ+ Q++ QL +QQ +
Sbjct: 218 LQQQQSQYQQQLQQQQQQWQSQQKQQQSQYQQQQQQQQQLQQQQQQQQQQLQQQQQQ 274


>UniRef50_Q75E28 Cluster: ABL158Cp; n=1; Eremothecium gossypii|Rep:
           ABL158Cp - Ashbya gossypii (Yeast) (Eremothecium
           gossypii)
          Length = 729

 Score = 35.5 bits (78), Expect = 1.1
 Identities = 20/73 (27%), Positives = 34/73 (46%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*E 271
           H+  +QH QQ+Q   ++P     Q   + ++QH+     QQ+     +QQ  Q   Q  +
Sbjct: 472 HLQQQQHQQQQQSLSQQPQQQQSQQSQAHSQQHQQQHQQQQQQQQPQQQQPQQHPPQQPQ 531

Query: 270 QQMELHRGYGRSE 232
           QQ       G+S+
Sbjct: 532 QQNSQQAIVGQSQ 544


>UniRef50_A7TS57 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 389

 Score = 35.5 bits (78), Expect = 1.1
 Identities = 33/112 (29%), Positives = 51/112 (45%), Gaps = 6/112 (5%)
 Frame = -1

Query: 552 SFVLSLCRKALCSFS---SIEQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLE 382
           SF+  L +K + + S   S +Q   Q    N L+   H+  +QH+QQ+Q +     + L 
Sbjct: 100 SFLNHLAQKQMPNQSGSPSQQQQQQQQQQQNYLQQQQHLQQQQHLQQQQQKNMFASSSLN 159

Query: 381 -QHQHSMAKQHRMPLLGQQEVP--HLLEQQKVQRRVQL*EQQMELHRGYGRS 235
            Q Q+ M   H    L QQ VP  H  +    Q+ +Q    Q    +G+G S
Sbjct: 160 AQQQNLMDTIHSQMNLQQQHVPQQHHHQLAAQQQHLQQVVPQQSQRQGHGHS 211


>UniRef50_Q9CL57 Cluster: Uncharacterized protein PM1386; n=1;
           Pasteurella multocida|Rep: Uncharacterized protein
           PM1386 - Pasteurella multocida
          Length = 112

 Score = 35.5 bits (78), Expect = 1.1
 Identities = 22/75 (29%), Positives = 31/75 (41%), Gaps = 6/75 (8%)
 Frame = +2

Query: 299 FCCSNRCGTSCCPSSGILCCFAILCWCCSNPA--SGSLHSPCSCCICCRLPIWSSTSSTF 472
           FCC++   T    ++         C C SN +  + S  + C+C +C  L   S   S  
Sbjct: 8   FCCASNSSTRFSNATNFSRVRINTCVCTSNSSRVTKSSFANCACNVCLSLASASCPKSLI 67

Query: 473 PV----WICTSVCSI 505
           P     WIC   CSI
Sbjct: 68  PCGRESWICCITCSI 82


>UniRef50_Q8WSW3 Cluster: Cadmium metallothionein precursor; n=8;
           Tetrahymena|Rep: Cadmium metallothionein precursor -
           Tetrahymena thermophila
          Length = 162

 Score = 35.5 bits (78), Expect = 1.1
 Identities = 16/54 (29%), Positives = 21/54 (38%)
 Frame = +2

Query: 266 CCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           CC   C +    CC +     CC S    CC +    CC+    G   + C CC
Sbjct: 63  CC---CGVNAKPCCFDPNSGCCCVSKTNNCCKSDTKECCTGTGEGCKCTSCQCC 113



 Score = 35.1 bits (77), Expect = 1.4
 Identities = 16/54 (29%), Positives = 21/54 (38%)
 Frame = +2

Query: 266 CCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           CC   C +    CC++     CC S    CC +    CC+    G     C CC
Sbjct: 7   CC---CGVNAKPCCTDPNSGCCCVSKTDNCCKSDTKECCTGTGEGCKCVNCKCC 57


>UniRef50_Q91TM5 Cluster: T71; n=1; Tupaiid herpesvirus 1|Rep: T71 -
           Tupaiid herpesvirus 1 (strain 1) (TuHV-1) (Herpesvirus
           tupaia (strain1))
          Length = 437

 Score = 35.1 bits (77), Expect = 1.4
 Identities = 15/35 (42%), Positives = 18/35 (51%), Gaps = 1/35 (2%)
 Frame = -2

Query: 437 GSICSRSRESVGSRWQDWSSTSIVWRSSI-GCRYW 336
           GS CS   E +GS W  W S  ++W S   GC  W
Sbjct: 377 GSSCSNGLEGIGSVWNAW-SVKMIWASGCSGCTIW 410


>UniRef50_A2A4M7 Cluster: Novel member of the keratin associated
           protein (Krtap) family; n=6; Murinae|Rep: Novel member
           of the keratin associated protein (Krtap) family - Mus
           musculus (Mouse)
          Length = 156

 Score = 35.1 bits (77), Expect = 1.4
 Identities = 24/70 (34%), Positives = 28/70 (40%), Gaps = 10/70 (14%)
 Frame = +2

Query: 248 PLCNSICCSYSCTLRCTF--CCS-NRCGTSCC------PSSGILCCFAILCW-CCSNPAS 397
           P C +ICC  SC     F  CC    C TSCC      P+  I+ C    C  CC  P +
Sbjct: 82  PTCVTICCVPSCCQPRLFQLCCQPTCCETSCCKTTSFKPTCVIIGCSTPCCQPCCVCPPA 141

Query: 398 GSLHSPCSCC 427
                P   C
Sbjct: 142 ADDQLPKKAC 151


>UniRef50_Q7KWV9 Cluster: Similar to Dictyostelium discoideum (Slime
           mold). Prespore-specific protein; n=2; Dictyostelium
           discoideum|Rep: Similar to Dictyostelium discoideum
           (Slime mold). Prespore-specific protein - Dictyostelium
           discoideum (Slime mold)
          Length = 652

 Score = 35.1 bits (77), Expect = 1.4
 Identities = 25/88 (28%), Positives = 46/88 (52%), Gaps = 5/88 (5%)
 Frame = -1

Query: 507 SIEQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHS-----MAKQHRMP 343
           +I+Q L Q H  + L+   H   +QH QQ+  + +  L   +QHQ       + +Q +  
Sbjct: 241 TIQQQLQQ-HQQHQLQHQQHQ--QQHQQQQHQQQQHQLQQQQQHQQQQQQQQLQQQQQQQ 297

Query: 342 LLGQQEVPHLLEQQKVQRRVQL*EQQME 259
            L QQ++ H   QQ++Q++ +  +QQ +
Sbjct: 298 QLQQQQLQHETIQQQIQQQHKQIQQQQQ 325



 Score = 32.7 bits (71), Expect = 7.5
 Identities = 16/66 (24%), Positives = 34/66 (51%)
 Frame = -1

Query: 447 MGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQ 268
           M  +Q  QQ+Q + ++     +Q Q    +Q +     QQ+    ++QQ+  ++ Q  +Q
Sbjct: 185 MHHQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQTIQQQQTIQQQQTIQQ 244

Query: 267 QMELHR 250
           Q++ H+
Sbjct: 245 QLQQHQ 250


>UniRef50_Q70LQ4 Cluster: Cysteine-rich protein; n=2; Enchytraeus
           buchholzi|Rep: Cysteine-rich protein - Enchytraeus
           buchholzi
          Length = 251

 Score = 35.1 bits (77), Expect = 1.4
 Identities = 23/67 (34%), Positives = 27/67 (40%), Gaps = 7/67 (10%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCC----FAILC--WCCSNPASGSLHSP 415
           C    C   CT RC   C  +CG   CP      C    F + C   CC+ P  G +  P
Sbjct: 112 CEKGECKPGCTKRC---CGTKCGVEDCPCGPSCKCEKGDFKVNCSKGCCT-PKCGVVGCP 167

Query: 416 C-SCCIC 433
           C S C C
Sbjct: 168 CGSQCTC 174


>UniRef50_Q54YK3 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 1813

 Score = 35.1 bits (77), Expect = 1.4
 Identities = 19/68 (27%), Positives = 35/68 (51%)
 Frame = -1

Query: 456 LDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL 277
           L H    Q  Q +Q + ++     +QHQH + +Q +     QQ++    +QQ+ Q++ Q 
Sbjct: 377 LQHHQQLQQQQNQQLQHQQIQIQHQQHQHQLHQQQQQHQHQQQQLQQQPQQQQQQQQQQQ 436

Query: 276 *EQQMELH 253
            +QQ + H
Sbjct: 437 QQQQQQHH 444


>UniRef50_Q54U49 Cluster: Putative uncharacterized protein; n=2;
           Eukaryota|Rep: Putative uncharacterized protein -
           Dictyostelium discoideum AX4
          Length = 2730

 Score = 35.1 bits (77), Expect = 1.4
 Identities = 24/84 (28%), Positives = 42/84 (50%), Gaps = 2/84 (2%)
 Frame = -1

Query: 504 IEQTLVQIHTGNVLEVLDHMGSRQHMQQEQ--GECREPLAGLEQHQHSMAKQHRMPLLGQ 331
           I+Q   Q+H   + +       + HMQQ+Q     ++P   + Q Q  + +QH    L  
Sbjct: 14  IQQQQQQLHQQQMQQQQMQQQQQHHMQQQQPMQHMQQPHHMIHQQQPIIIQQH----LHH 69

Query: 330 QEVPHLLEQQKVQRRVQL*EQQME 259
           Q  PH+ +QQ+ Q++ Q  +QQ +
Sbjct: 70  QIHPHIQQQQQQQQQQQQQQQQQQ 93



 Score = 32.7 bits (71), Expect = 7.5
 Identities = 21/78 (26%), Positives = 36/78 (46%)
 Frame = -1

Query: 486 QIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLE 307
           Q H     + + HM    HM  +Q    +P+  ++QH H     H      QQ+     +
Sbjct: 35  QQHHMQQQQPMQHMQQPHHMIHQQ----QPII-IQQHLHHQIHPHIQQQQQQQQQQQQQQ 89

Query: 306 QQKVQRRVQL*EQQMELH 253
           QQ+ Q++ Q  +QQ ++H
Sbjct: 90  QQQQQQQQQQQQQQQQVH 107


>UniRef50_Q54LZ1 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 969

 Score = 35.1 bits (77), Expect = 1.4
 Identities = 20/78 (25%), Positives = 38/78 (48%)
 Frame = -1

Query: 483 IHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQ 304
           + T    + +  M S    QQ+Q + ++     +Q QH      +  LL QQ++    +Q
Sbjct: 570 LQTLQAAQAIQSMQSMHQQQQQQQQQQQQQQQQQQQQHPQLSIQQQALLQQQQLQQQQQQ 629

Query: 303 QKVQRRVQL*EQQMELHR 250
           Q+ Q++ Q  +QQ + H+
Sbjct: 630 QQQQQQHQ--QQQQQQHQ 645


>UniRef50_Q4V4J0 Cluster: IP04080p; n=1; Drosophila
           melanogaster|Rep: IP04080p - Drosophila melanogaster
           (Fruit fly)
          Length = 176

 Score = 35.1 bits (77), Expect = 1.4
 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 8/40 (20%)
 Frame = +2

Query: 260 SICCSYSCTLRCT----FCCSN----RCGTSCCPSSGILC 355
           SICCS+   LRC+     CC+     RC T  CPS+  LC
Sbjct: 123 SICCSHCHPLRCSVRPSLCCARFGQIRCSTGLCPSTFELC 162


>UniRef50_Q23CT2 Cluster: Putative uncharacterized protein; n=1;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 1438

 Score = 35.1 bits (77), Expect = 1.4
 Identities = 27/113 (23%), Positives = 51/113 (45%), Gaps = 1/113 (0%)
 Frame = -1

Query: 579 QYKLLSTNKSFVLSLCRKALCSFSSIEQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECRE 400
           QY  +S N  FV     ++  SF   +     +   N  +V+    S+QH+ Q+Q + ++
Sbjct: 303 QYPQISANMQFVYPHLIQSQGSFLLSQPNYNFVQIPNQNQVIQQQPSQQHLSQQQQQLQQ 362

Query: 399 PLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMEL-HRGY 244
            +    Q+Q+ M  +  +     Q++   L+    Q  +Q   QQ +L H+ Y
Sbjct: 363 GIV-QNQNQNVMHTESAIKQSFNQQIASNLKANSQQHYMQQVTQQQQLQHQQY 414


>UniRef50_Q6CPW4 Cluster: Similarities with sp|Q03825 Saccharomyces
           cerevisiae YMR164c MSS11 activator of STA1; n=1;
           Kluyveromyces lactis|Rep: Similarities with sp|Q03825
           Saccharomyces cerevisiae YMR164c MSS11 activator of STA1
           - Kluyveromyces lactis (Yeast) (Candida sphaerica)
          Length = 539

 Score = 35.1 bits (77), Expect = 1.4
 Identities = 16/59 (27%), Positives = 30/59 (50%)
 Frame = -1

Query: 456 LDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQ 280
           L     +Q  QQ+Q + ++     +Q QH   +QH+     QQ+  H  +QQ+++ + Q
Sbjct: 333 LQQKQQQQQQQQQQQQQQQQQQQQQQQQHQQQQQHQQQQQHQQQQQHQQQQQQIRMQYQ 391


>UniRef50_Q4PHZ9 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 836

 Score = 35.1 bits (77), Expect = 1.4
 Identities = 23/77 (29%), Positives = 32/77 (41%), Gaps = 4/77 (5%)
 Frame = +2

Query: 302 CCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLH-SPCSCCICCRLPIWSSTSSTFPV 478
           C    CG +   +S I+C  A+   CC + A   +  SPCS   C     +SS +   P+
Sbjct: 97  CTQPSCGAASSSTSAIVCSTAVA--CCDDTACAEISGSPCSQSTCSASGDFSSMTLAVPI 154

Query: 479 --WICT-SVCSIDEKEH 520
               CT   C  D   H
Sbjct: 155 LSTCCTDDACETDPALH 171


>UniRef50_Q9VDR1 Cluster: Mediator of RNA polymerase II
           transcription subunit 25; n=1; Drosophila
           melanogaster|Rep: Mediator of RNA polymerase II
           transcription subunit 25 - Drosophila melanogaster
           (Fruit fly)
          Length = 863

 Score = 35.1 bits (77), Expect = 1.4
 Identities = 21/65 (32%), Positives = 37/65 (56%)
 Frame = -1

Query: 441 SRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQM 262
           S Q  QQ+Q + ++     +Q Q    +Q RM +L QQ+   +L  Q++Q++ QL +QQ 
Sbjct: 404 SLQQQQQQQAQQQQQ----QQQQAQQQQQQRMQMLSQQQ---MLNHQQLQQQQQLAQQQQ 456

Query: 261 ELHRG 247
           +  +G
Sbjct: 457 QQQQG 461


>UniRef50_UPI00015B4328 Cluster: PREDICTED: similar to DNA binding
           protein; n=1; Nasonia vitripennis|Rep: PREDICTED:
           similar to DNA binding protein - Nasonia vitripennis
          Length = 771

 Score = 34.7 bits (76), Expect = 1.9
 Identities = 26/93 (27%), Positives = 44/93 (47%), Gaps = 4/93 (4%)
 Frame = -1

Query: 501 EQTLVQIHTGNVLEVLDHMGSR-QHMQQEQGECREPLAGLE---QHQHSMAKQHRMPLLG 334
           +QT V     N  ++   +  + Q  Q+EQ E +  L  +E   Q Q    +Q +     
Sbjct: 276 QQTHVSQEQQNQTQITQQLQQQIQRQQREQFEKQRHLQHIEKQHQQQQQQQQQQQQQQQH 335

Query: 333 QQEVPHLLEQQKVQRRVQL*EQQMELHRGYGRS 235
           QQ+  H  +QQ+ Q++ Q  +QQ + H+   RS
Sbjct: 336 QQQQQHQQQQQQQQQQQQQQQQQQQQHQEVLRS 368


>UniRef50_UPI0000E4956C Cluster: PREDICTED: similar to MondoA; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           MondoA - Strongylocentrotus purpuratus
          Length = 1338

 Score = 34.7 bits (76), Expect = 1.9
 Identities = 18/63 (28%), Positives = 33/63 (52%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           ++  QQ+Q + ++     +Q Q    +Q +     QQ+    LEQQK Q+++Q  +QQ +
Sbjct: 687 QKQQQQQQAQGQQQQQQQQQQQQQQQQQQQQQQQKQQQQQQQLEQQKQQQQLQQKQQQAQ 746

Query: 258 LHR 250
             R
Sbjct: 747 QRR 749


>UniRef50_Q3WCX6 Cluster: Similar to ATPase; n=2;
           Actinomycetales|Rep: Similar to ATPase - Frankia sp.
           EAN1pec
          Length = 674

 Score = 34.7 bits (76), Expect = 1.9
 Identities = 19/50 (38%), Positives = 23/50 (46%)
 Frame = +2

Query: 248 PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPAS 397
           P C S+CCS+     C+ CCS     S     G   C +  C CCS P S
Sbjct: 42  PRC-SVCCSWPACSGCSGCCSRPGPASRAHHWGYSSC-SERCPCCSRPWS 89



 Score = 33.9 bits (74), Expect = 3.3
 Identities = 24/64 (37%), Positives = 27/64 (42%), Gaps = 10/64 (15%)
 Frame = +2

Query: 308 SNRCGTSCCPSSGILCCFAILC----WCCSNPASGSL-----HSPCS-CCICCRLPIWSS 457
           S   GT  CP    +CC    C     CCS P   S      +S CS  C CC  P WS 
Sbjct: 32  SGTSGTCGCPPRCSVCCSWPACSGCSGCCSRPGPASRAHHWGYSSCSERCPCCSRP-WSR 90

Query: 458 TSST 469
            S+T
Sbjct: 91  ASTT 94


>UniRef50_A5C3P9 Cluster: Putative uncharacterized protein; n=2;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 489

 Score = 34.7 bits (76), Expect = 1.9
 Identities = 20/55 (36%), Positives = 30/55 (54%)
 Frame = -1

Query: 429 MQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQ 265
           MQ   G    PL+GL+Q+Q S  +Q    +L QQ  P +L QQ+  ++  +  QQ
Sbjct: 285 MQTSSGMQSAPLSGLQQNQPSSVQQSSQSVL-QQHPPAVLRQQQQPQQTPIMHQQ 338


>UniRef50_Q9VSJ0 Cluster: Ecdysone-inducible gene E1; n=4;
           Drosophila melanogaster|Rep: Ecdysone-inducible gene E1
           - Drosophila melanogaster (Fruit fly)
          Length = 1616

 Score = 34.7 bits (76), Expect = 1.9
 Identities = 24/105 (22%), Positives = 44/105 (41%)
 Frame = -1

Query: 510 SSIEQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQ 331
           + +   +V++  G  LE +D       + Q+Q +  E     E+ +H   +QHR+     
Sbjct: 276 TKLRPEVVEVDNGEKLEAVDLAHEETELTQQQNQLDEQQHQEEEQKHQEEEQHRIEQQQN 335

Query: 330 QEVPHLLEQQKVQRRVQL*EQQMELHRGYGRSEGRCCYQRTQCPA 196
           QE     EQQ+ Q + Q+ +Q  +        +     Q+   PA
Sbjct: 336 QEE----EQQQQQHQQQVIDQASDAELPQSSQDATTGVQQLLTPA 376


>UniRef50_Q86AF2 Cluster: Similar to Dictyostelium discoideum (Slime
           mold). Adenylyl cyclase; n=2; Dictyostelium
           discoideum|Rep: Similar to Dictyostelium discoideum
           (Slime mold). Adenylyl cyclase - Dictyostelium
           discoideum (Slime mold)
          Length = 1212

 Score = 34.7 bits (76), Expect = 1.9
 Identities = 18/62 (29%), Positives = 36/62 (58%)
 Frame = -1

Query: 435 QHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMEL 256
           Q  QQ+Q + ++  A L+Q Q +  +Q +   L QQ+      QQ+ Q++ Q  +QQ+++
Sbjct: 407 QQQQQQQAQLQQQQAQLQQQQQAQLQQQQQAQLQQQQ----QAQQQAQQQAQQQQQQLKI 462

Query: 255 HR 250
           ++
Sbjct: 463 YQ 464


>UniRef50_Q5CRJ9 Cluster: Ubiquitin C-terminal hydrolase of the
           cysteine proteinase fold; n=2; Cryptosporidium|Rep:
           Ubiquitin C-terminal hydrolase of the cysteine
           proteinase fold - Cryptosporidium parvum Iowa II
          Length = 1619

 Score = 34.7 bits (76), Expect = 1.9
 Identities = 18/61 (29%), Positives = 33/61 (54%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q +QQ+Q + +      +Q Q    +Q       QQ+   L +QQ++Q++ QL +QQ +
Sbjct: 691 QQQLQQQQQQQQHLQQQQQQQQQQQQQQRHQQQQQQQQQQQLQQQQQLQQQQQLQQQQQQ 750

Query: 258 L 256
           L
Sbjct: 751 L 751


>UniRef50_Q54JH9 Cluster: Putative uncharacterized protein; n=2;
            Dictyostelium discoideum AX4|Rep: Putative
            uncharacterized protein - Dictyostelium discoideum AX4
          Length = 2950

 Score = 34.7 bits (76), Expect = 1.9
 Identities = 20/62 (32%), Positives = 33/62 (53%)
 Frame = -1

Query: 438  RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
            + H QQ+Q +     A L Q Q    +Q +  L  QQ++ H  +QQ  Q+++ L +QQ +
Sbjct: 1139 QHHQQQQQQQHHNQQAQLYQQQQQQIQQAQ--LYQQQQLYHQQQQQLYQQQLYLQQQQQQ 1196

Query: 258  LH 253
             H
Sbjct: 1197 QH 1198


>UniRef50_Q54GP2 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 805

 Score = 34.7 bits (76), Expect = 1.9
 Identities = 16/63 (25%), Positives = 35/63 (55%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           R+  Q+EQ +  +     +Q Q  M +Q R   + QQ+    +EQQ+ Q++++  ++Q +
Sbjct: 293 REQQQREQQQREQQQREQQQRQQQMEQQQRQQQMEQQQRQQQMEQQQRQQQMEQQQRQQQ 352

Query: 258 LHR 250
           + +
Sbjct: 353 MEQ 355



 Score = 33.9 bits (74), Expect = 3.3
 Identities = 18/60 (30%), Positives = 34/60 (56%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           R+  Q+EQ + R+     +Q Q  M +Q R   + QQ+    +EQQ+ Q++++  +QQ +
Sbjct: 303 REQQQREQQQ-RQQQMEQQQRQQQMEQQQRQQQMEQQQRQQQMEQQQRQQQMEQQQQQQQ 361



 Score = 33.1 bits (72), Expect = 5.7
 Identities = 20/63 (31%), Positives = 33/63 (52%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ + + R+     +Q Q  M +Q R   + QQ+    +EQQ+ Q+  Q  +QQ E
Sbjct: 311 QQRQQQMEQQQRQQQMEQQQRQQQMEQQQRQQQMEQQQRQQQMEQQQQQQ--QRIQQQRE 368

Query: 258 LHR 250
           L +
Sbjct: 369 LRK 371


>UniRef50_Q4UHZ5 Cluster: Putative uncharacterized protein; n=2;
           Theileria|Rep: Putative uncharacterized protein -
           Theileria annulata
          Length = 1082

 Score = 34.7 bits (76), Expect = 1.9
 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 8/48 (16%)
 Frame = +2

Query: 263 ICCSYSC-----TLRCTFCCSNRCGTSCCPSSGILCCFAI---LCWCC 382
           +CC   C     T  C+  CS  CGT CC   G +C + +   +  CC
Sbjct: 459 VCCCPECKNSINTCSCSQPCSESCGTECCCKEGKVCHYLLRNCVASCC 506


>UniRef50_Q4U8N7 Cluster: Hypothetical product; n=4; Theileria|Rep:
            Hypothetical product - Theileria annulata
          Length = 1022

 Score = 34.7 bits (76), Expect = 1.9
 Identities = 20/89 (22%), Positives = 31/89 (34%), Gaps = 2/89 (2%)
 Frame = +2

Query: 251  LCNSICCSYSCTLRCTFCCSNRCGTSCC--PSSGILCCFAILCWCCSNPASGSLHSPCSC 424
            +C   C       +C    SN+    CC   +S   CC + L  C +N       S C  
Sbjct: 898  ICCKCCSCNQQKSQCQCSSSNQTSNHCCCKTASSCPCCKSTLGCCSTNITHCKCCSECEK 957

Query: 425  CICCRLPIWSSTSSTFPVWICTSVCSIDE 511
            C+C  L    +      +  C   C+  +
Sbjct: 958  CVCICLKRIKNEDKDTDIIFCFFECTFKD 986


>UniRef50_Q2KPA5 Cluster: Clock; n=1; Macrobrachium rosenbergii|Rep:
           Clock - Macrobrachium rosenbergii (Giant fresh water
           prawn)
          Length = 704

 Score = 34.7 bits (76), Expect = 1.9
 Identities = 21/84 (25%), Positives = 40/84 (47%), Gaps = 3/84 (3%)
 Frame = -1

Query: 501 EQTLVQIH---TGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQ 331
           E  + Q H   T N  + + H+  +Q  QQ+Q + ++     +Q Q    +Q +     Q
Sbjct: 486 EHNIPQTHLPLTQNQQQHIQHLQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ 545

Query: 330 QEVPHLLEQQKVQRRVQL*EQQME 259
           Q+     +QQ+ Q++ Q  +QQ +
Sbjct: 546 QQQQQQQQQQQQQQQQQQQQQQQQ 569



 Score = 33.5 bits (73), Expect = 4.3
 Identities = 19/77 (24%), Positives = 38/77 (49%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ+Q + ++     +Q Q    +Q +     Q +     +QQ+ Q++ QL +QQ++
Sbjct: 581 QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQEQQQQQHQQQQQQQQQQQQQQQQLQQQQLQ 640

Query: 258 LHRGYGRSEGRCCYQRT 208
            H    +   +C  Q+T
Sbjct: 641 QHLQQQQHMTQCMPQQT 657



 Score = 32.3 bits (70), Expect = 10.0
 Identities = 17/63 (26%), Positives = 32/63 (50%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ+Q + ++     +Q Q    +Q +     QQ+     +QQ+ Q++ Q  EQQ +
Sbjct: 556 QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQEQQQQ 615

Query: 258 LHR 250
            H+
Sbjct: 616 QHQ 618


>UniRef50_Q236J9 Cluster: Leishmanolysin family protein; n=1;
           Tetrahymena thermophila SB210|Rep: Leishmanolysin family
           protein - Tetrahymena thermophila SB210
          Length = 5199

 Score = 34.7 bits (76), Expect = 1.9
 Identities = 18/55 (32%), Positives = 22/55 (40%)
 Frame = +2

Query: 269 CSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCIC 433
           CS  C L C  C S +  T C   S      +  C  CS+P S  + S   C  C
Sbjct: 660 CSPICDLSCLTCSSPKDATKCLSCSDGYFLSSGKCQQCSSPCSKCVDSASKCLSC 714


>UniRef50_Q23390 Cluster: Putative uncharacterized protein pqn-95;
           n=2; Caenorhabditis|Rep: Putative uncharacterized
           protein pqn-95 - Caenorhabditis elegans
          Length = 373

 Score = 34.7 bits (76), Expect = 1.9
 Identities = 19/65 (29%), Positives = 24/65 (36%), Gaps = 3/65 (4%)
 Frame = +2

Query: 248 PLCNSIC---CSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPC 418
           P+C   C   C  +C   C   C   C +SC  +   +   A     CSN  S    S C
Sbjct: 207 PICIQSCQSSCQQACQPTCQPQCMPSCSSSCTSNQAPIVIVAQQGDSCSNSCSNQCQSAC 266

Query: 419 SCCIC 433
              IC
Sbjct: 267 PTPIC 271



 Score = 32.3 bits (70), Expect = 10.0
 Identities = 23/84 (27%), Positives = 31/84 (36%), Gaps = 2/84 (2%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSL--HSPCSCC 427
           CN+ C S   T  C   C + C  +C P+    C  +    C SN A   +      SC 
Sbjct: 196 CNNQCSSSCSTPICIQSCQSSCQQACQPTCQPQCMPSCSSSCTSNQAPIVIVAQQGDSCS 255

Query: 428 ICCRLPIWSSTSSTFPVWICTSVC 499
             C     S+  +   V  C S C
Sbjct: 256 NSCSNQCQSACPTPICVQQCNSQC 279


>UniRef50_A0C230 Cluster: Chromosome undetermined scaffold_143,
           whole genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_143,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 1007

 Score = 34.7 bits (76), Expect = 1.9
 Identities = 16/60 (26%), Positives = 34/60 (56%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q+++Q Q + ++    LE+ Q    +  +   + QQ+   LL+QQ+ Q++ Q  +QQ +
Sbjct: 705 QQNLEQNQSQQQQDSQQLEKQQQQQLQSEQQQSIQQQQQQQLLQQQQQQQQQQQQQQQQQ 764


>UniRef50_Q5A188 Cluster: Putative uncharacterized protein; n=2;
           Candida albicans|Rep: Putative uncharacterized protein -
           Candida albicans (Yeast)
          Length = 182

 Score = 34.7 bits (76), Expect = 1.9
 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 2/34 (5%)
 Frame = +2

Query: 290 RCTFCCSNRCGTSCCPSSGILCCFAIL--CWCCS 385
           RC  CC   C   CC    IL CF I   CW CS
Sbjct: 17  RCCCCCC--CCCCCCCCCNILLCFCICSKCWICS 48


>UniRef50_P15618 Cluster: Uncharacterized mitochondrial protein
           ORF17; n=1; Paramecium tetraurelia|Rep: Uncharacterized
           mitochondrial protein ORF17 - Paramecium tetraurelia
          Length = 221

 Score = 34.7 bits (76), Expect = 1.9
 Identities = 21/62 (33%), Positives = 28/62 (45%), Gaps = 1/62 (1%)
 Frame = +2

Query: 323 TSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCICCRLPIWS-STSSTFPVWICTSVC 499
           +SCC    ++   A   W CS P+  SL S C  C+   L  WS STS    V+     C
Sbjct: 7   SSCC--FFLVSTSAFCSWVCSRPSQSSLCSLCLSCLFFILLFWSPSTSYLILVFFLLYTC 64

Query: 500 SI 505
            +
Sbjct: 65  VV 66


>UniRef50_UPI00015B58BD Cluster: PREDICTED: hypothetical protein;
           n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical
           protein - Nasonia vitripennis
          Length = 430

 Score = 34.3 bits (75), Expect = 2.5
 Identities = 17/57 (29%), Positives = 22/57 (38%), Gaps = 1/57 (1%)
 Frame = +2

Query: 269 CSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASG-SLHSPCSCCICC 436
           C  +C  +C  CCS +    CC   G  C     C  C + +        C CC CC
Sbjct: 274 CGKNC--KCCGCCSGKKEGCCCNKGGAEC---KCCDACGDDSKDCKCGKECKCCGCC 325



 Score = 33.9 bits (74), Expect = 3.3
 Identities = 18/58 (31%), Positives = 23/58 (39%), Gaps = 2/58 (3%)
 Frame = +2

Query: 269 CSYSCTLRCTFCCSNRCGTSCCPSSG--ILCCFAILCWCCSNPASGSLHSPCSCCICC 436
           C  +C  +C  CC  +    CC  SG    CC A    C  +    +    C CC CC
Sbjct: 233 CGNNC--KCCGCCDGKKKGCCCSKSGGDCECCGA----CGDDSKDCNCGKNCKCCGCC 284



 Score = 33.1 bits (72), Expect = 5.7
 Identities = 20/61 (32%), Positives = 21/61 (34%), Gaps = 2/61 (3%)
 Frame = +2

Query: 260 SICCSYSCTLRCTFCCSNRCGTSC--CPSSGILCCFAILCWCCSNPASGSLHSPCSCCIC 433
           S CC+      C  CC   CG     C   G   C    C CC     G     C CCI 
Sbjct: 89  SCCCAAETGKDCQ-CCG-ACGDKSKECKCEGECKC----CCCCVKSGDGKDGEGCVCCIA 142

Query: 434 C 436
           C
Sbjct: 143 C 143


>UniRef50_UPI0000499BF3 Cluster: hypothetical protein 151.t00004;
           n=1; Entamoeba histolytica HM-1:IMSS|Rep: hypothetical
           protein 151.t00004 - Entamoeba histolytica HM-1:IMSS
          Length = 535

 Score = 34.3 bits (75), Expect = 2.5
 Identities = 23/85 (27%), Positives = 32/85 (37%), Gaps = 2/85 (2%)
 Frame = +2

Query: 251 LCNSICCSYSCT--LRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSC 424
           +C   C S  C+  L C   C   C ++CC  +   CC     W C N         C C
Sbjct: 459 MCCIECTSDGCSEFLSCCSPCCEWCCSNCC--NDCECCENFCEWYCEN---------CCC 507

Query: 425 CICCRLPIWSSTSSTFPVWICTSVC 499
           C        SS    F  ++C ++C
Sbjct: 508 CFDEMCSFLSSCCDCFCDFLCDTLC 532


>UniRef50_UPI0000D8B557 Cluster: UPI0000D8B557 related cluster; n=1;
           Mus musculus|Rep: UPI0000D8B557 UniRef100 entry - Mus
           musculus
          Length = 404

 Score = 34.3 bits (75), Expect = 2.5
 Identities = 24/84 (28%), Positives = 32/84 (38%), Gaps = 5/84 (5%)
 Frame = +2

Query: 260 SICCSYSCTL----RCTFCCSNRCGTS-CCPSSGILCCFAILCWCCSNPASGSLHSPCSC 424
           ++C  YSC L     C  C S  C    CC     LCC   +  C     S  L    SC
Sbjct: 190 ALCYRYSCALCYSYSCAVCYSYSCAVQLCCVLQVQLCCVLQVQLCSVLQVSCPLCYSYSC 249

Query: 425 CICCRLPIWSSTSSTFPVWICTSV 496
            +C    +  +T +  P    T+V
Sbjct: 250 PLCYITAVPCATGTAVPCATGTAV 273



 Score = 32.7 bits (71), Expect = 7.5
 Identities = 18/65 (27%), Positives = 28/65 (43%), Gaps = 3/65 (4%)
 Frame = +2

Query: 263 ICCSYSCTLRCTFCCSNRCGTSC--CPSSGILCCFAILCWCCSNPASGSLHS-PCSCCIC 433
           +C SYSC L   + C+     SC  C       C+   C  C + +    +S  C+  +C
Sbjct: 159 LCYSYSCALCYRYSCAVCYSYSCALCYRYSCALCYRYSCALCYSYSCAVCYSYSCAVQLC 218

Query: 434 CRLPI 448
           C L +
Sbjct: 219 CVLQV 223


>UniRef50_Q6GZT3 Cluster: Putative uncharacterized protein; n=1;
           Frog virus 3|Rep: Putative uncharacterized protein -
           Frog virus 3 (FV3)
          Length = 171

 Score = 34.3 bits (75), Expect = 2.5
 Identities = 23/78 (29%), Positives = 31/78 (39%), Gaps = 10/78 (12%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILC--CFAILCWC--CSNPA---SGSLHS 412
           C+   CS+     C++C  + C  S C  S   C  C+   CWC  C +      G L  
Sbjct: 52  CSWCWCSWCSWCWCSWCWCSWCWCSWCWCSWCWCSWCWCSWCWCSWCLSKGWEDRGGLEG 111

Query: 413 PCSC---CICCRLPIWSS 457
             SC   C+C     W S
Sbjct: 112 CKSCKGWCLCSHCWCWCS 129


>UniRef50_Q61118 Cluster: Glutamine repeat protein-1; n=5;
           Eukaryota|Rep: Glutamine repeat protein-1 - Mus musculus
           (Mouse)
          Length = 171

 Score = 34.3 bits (75), Expect = 2.5
 Identities = 20/83 (24%), Positives = 37/83 (44%)
 Frame = -1

Query: 453 DHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL* 274
           D     Q  QQ+Q + ++     +  QH   +QH+     QQ   H   QQ  Q +    
Sbjct: 43  DQHQQHQQQQQQQQQQQQHQQHQQHQQHQQHQQHQQHQQHQQHQQHQQHQQHQQHQQHQQ 102

Query: 273 EQQMELHRGYGRSEGRCCYQRTQ 205
           +QQ + H+ + + + +  +Q+ Q
Sbjct: 103 QQQHQQHQQHQQQQQQQQHQQHQ 125



 Score = 33.9 bits (74), Expect = 3.3
 Identities = 22/83 (26%), Positives = 38/83 (45%), Gaps = 1/83 (1%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQH-QHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL* 274
           H   +QH Q +Q +  +     +QH QH   +QH+     QQ   H  +QQ+ Q+  Q  
Sbjct: 67  HQQHQQHQQHQQHQQHQQHQQHQQHQQHQQHQQHQQQQQHQQHQQH-QQQQQQQQHQQHQ 125

Query: 273 EQQMELHRGYGRSEGRCCYQRTQ 205
           + Q   H+ +   + +   Q+ Q
Sbjct: 126 QHQQHQHQQHQHQQHQQHQQQQQ 148



 Score = 33.5 bits (73), Expect = 4.3
 Identities = 20/78 (25%), Positives = 35/78 (44%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ+Q + ++     +  QH   +QH+     QQ   H   QQ  Q + Q   QQ +
Sbjct: 51  QQQQQQQQQQHQQHQQHQQHQQHQQHQQHQQHQQHQQHQQHQQHQQHQQHQQQQQHQQHQ 110

Query: 258 LHRGYGRSEGRCCYQRTQ 205
            H+   + +    +Q+ Q
Sbjct: 111 QHQQQQQQQQHQQHQQHQ 128



 Score = 33.1 bits (72), Expect = 5.7
 Identities = 22/83 (26%), Positives = 35/83 (42%), Gaps = 1/83 (1%)
 Frame = -1

Query: 450 HMGSRQHMQ-QEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL* 274
           H   +QH Q Q Q   ++     +Q QH   +QH+     QQ   H   QQ  Q +    
Sbjct: 34  HQQHQQHQQDQHQQHQQQQQQQQQQQQHQQHQQHQQHQQHQQHQQHQQHQQHQQHQQHQQ 93

Query: 273 EQQMELHRGYGRSEGRCCYQRTQ 205
            QQ + H+   + +    +Q+ Q
Sbjct: 94  HQQHQQHQQQQQHQQHQQHQQQQ 116


>UniRef50_Q3TS98 Cluster: In vitro fertilized eggs cDNA, RIKEN
           full-length enriched library, clone:7420449K20
           product:biliverdin reductase A, full insert sequence;
           n=2; Mus musculus|Rep: In vitro fertilized eggs cDNA,
           RIKEN full-length enriched library, clone:7420449K20
           product:biliverdin reductase A, full insert sequence -
           Mus musculus (Mouse)
          Length = 290

 Score = 34.3 bits (75), Expect = 2.5
 Identities = 24/80 (30%), Positives = 32/80 (40%), Gaps = 10/80 (12%)
 Frame = +2

Query: 236 LLP*PLCNSICCSYSCTLRCTF------CCSNRCGTSCCPSSGIL---CCFAILCWCCSN 388
           LLP  +  + CC++ C L C         C   C    CP    +   CC A     C  
Sbjct: 151 LLPAAVPTACCCAW-CLLLCLLPAAIHGACCCACCLLLCPLPAAMHGACCCACCLLLCLL 209

Query: 389 PASGSLHSPCSCC-ICCRLP 445
           PA+      C+CC + C LP
Sbjct: 210 PAAVPAACCCACCLLLCPLP 229


>UniRef50_Q0LEI4 Cluster: Putative expression regulator; n=1;
           Herpetosiphon aurantiacus ATCC 23779|Rep: Putative
           expression regulator - Herpetosiphon aurantiacus ATCC
           23779
          Length = 474

 Score = 34.3 bits (75), Expect = 2.5
 Identities = 15/48 (31%), Positives = 17/48 (35%)
 Frame = +2

Query: 293 CTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCICC 436
           C   C + C  +CC       C    C CC     G   S C C  CC
Sbjct: 423 CDDDCCDCCQCTCCCCDATDACEGDGCSCCECGGCGECGSCCECGDCC 470


>UniRef50_Q9XUS0 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 294

 Score = 34.3 bits (75), Expect = 2.5
 Identities = 18/62 (29%), Positives = 21/62 (33%), Gaps = 2/62 (3%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSG--ILCCFAILCWCCSNPASGSLHSPCSCC 427
           CNS C     T  CT  CSN C  +C       I+         C N       S C+  
Sbjct: 132 CNSQCLQICTTPSCTNTCSNSCSNACSNGGNQPIVIVIPSSSRNCQNSCQNQCSSACTTM 191

Query: 428 IC 433
            C
Sbjct: 192 TC 193



 Score = 34.3 bits (75), Expect = 2.5
 Identities = 27/84 (32%), Positives = 36/84 (42%), Gaps = 2/84 (2%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPC--SCC 427
           C + C S   T+ C   C N C  SC   SG          C SN ++  + +PC  SC 
Sbjct: 180 CQNQCSSACTTMTCRQTCQNTCLGSCNSCSG--------GGCNSNNSNLVVVTPCERSCN 231

Query: 428 ICCRLPIWSSTSSTFPVWICTSVC 499
             CR    S+ SST  + +C   C
Sbjct: 232 SGCR----STCSSTSTLSVCIPAC 251


>UniRef50_Q5TR79 Cluster: ENSANGP00000025827; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000025827 - Anopheles gambiae
           str. PEST
          Length = 125

 Score = 34.3 bits (75), Expect = 2.5
 Identities = 17/40 (42%), Positives = 19/40 (47%)
 Frame = +2

Query: 326 SCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCICCRLP 445
           SC  +   LC  A +C C    A  SLH  C CC  CR P
Sbjct: 24  SCSNNEKRLCLRACVCVC---GACDSLHCYCCCCCACRSP 60


>UniRef50_Q554Z4 Cluster: Histidine kinase; n=3; Dictyostelium
           discoideum|Rep: Histidine kinase - Dictyostelium
           discoideum AX4
          Length = 1671

 Score = 34.3 bits (75), Expect = 2.5
 Identities = 22/68 (32%), Positives = 34/68 (50%)
 Frame = -1

Query: 462 EVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRV 283
           + L  +  +   QQ+Q + ++ L    + Q S  KQ   P   QQE P L +QQ+ Q + 
Sbjct: 113 QTLLELNQKFQEQQQQQQQQQQLQKQNKQQQSQ-KQQEEPPSSQQEEPPLSQQQQEQEQE 171

Query: 282 QL*EQQME 259
           Q  EQ+ E
Sbjct: 172 QEQEQEQE 179


>UniRef50_Q54VU4 Cluster: Putative uncharacterized protein; n=2;
            Eukaryota|Rep: Putative uncharacterized protein -
            Dictyostelium discoideum AX4
          Length = 1505

 Score = 34.3 bits (75), Expect = 2.5
 Identities = 26/89 (29%), Positives = 43/89 (48%), Gaps = 1/89 (1%)
 Frame = -1

Query: 438  RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
            +QH  Q+Q   ++     +QHQH   +Q ++     Q+  H   QQ  Q+  Q  +QQ +
Sbjct: 981  QQHQHQQQHSPQQQQH--QQHQHHQQQQQQLQQQHHQQ-HHQQHQQHQQQHQQQHQQQHQ 1037

Query: 258  LHRGYGRSEGR-CCYQRTQCPAGDINLCS 175
             H+ + +S  +   Y  TQ  + D NL S
Sbjct: 1038 QHQQHQQSHQQPPVYFPTQIISDDFNLTS 1066


>UniRef50_Q54UJ3 Cluster: Paired amphipathic helix (PAH) containing
           protein; n=1; Dictyostelium discoideum AX4|Rep: Paired
           amphipathic helix (PAH) containing protein -
           Dictyostelium discoideum AX4
          Length = 1934

 Score = 34.3 bits (75), Expect = 2.5
 Identities = 17/49 (34%), Positives = 29/49 (59%)
 Frame = -1

Query: 405 REPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           + P A LEQ Q  M +Q ++    QQ+   +L+QQ+ Q++ Q  +QQ +
Sbjct: 696 QNPNAVLEQQQQQMLQQQQLQQQQQQQQQQMLQQQQQQQQQQQLQQQQQ 744


>UniRef50_Q54FZ7 Cluster: Putative uncharacterized protein; n=4;
            Eukaryota|Rep: Putative uncharacterized protein -
            Dictyostelium discoideum AX4
          Length = 5650

 Score = 34.3 bits (75), Expect = 2.5
 Identities = 30/107 (28%), Positives = 48/107 (44%), Gaps = 4/107 (3%)
 Frame = -1

Query: 573  KLLSTNKSFVLSLCRKALCSFSSIEQTLVQIHTGNVL----EVLDHMGSRQHMQQEQGEC 406
            KLL   +   L  C K+L   S +EQ L      NV      +++     Q+ QQ+Q + 
Sbjct: 2934 KLLQIARPESLYKCTKSLPK-SYVEQYLSNQEHFNVYLFLKNLVESFSKNQNQQQQQQQQ 2992

Query: 405  REPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQ 265
            +E     EQ Q    +Q +     QQ+     +QQ+ Q++ Q  +QQ
Sbjct: 2993 QELEVDSEQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ 3039


>UniRef50_A0C569 Cluster: Chromosome undetermined scaffold_15, whole
            genome shotgun sequence; n=2; Paramecium tetraurelia|Rep:
            Chromosome undetermined scaffold_15, whole genome shotgun
            sequence - Paramecium tetraurelia
          Length = 1270

 Score = 34.3 bits (75), Expect = 2.5
 Identities = 20/90 (22%), Positives = 45/90 (50%)
 Frame = -1

Query: 513  FSSIEQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLG 334
            +  I+Q+ +     +  E ++ + S +H QQ   + ++P +  +Q Q   ++Q +     
Sbjct: 741  YKQIKQSDISSQYSHQYEEVNQLHSDKH-QQPYSQQQQPFSQYQQQQQIYSQQQQQQQQQ 799

Query: 333  QQEVPHLLEQQKVQRRVQL*EQQMELHRGY 244
            QQ+     +QQ+ Q++ Q  +QQ +  + Y
Sbjct: 800  QQQQQQQQQQQQQQQQQQQQQQQQQQQQQY 829


>UniRef50_Q7S0G4 Cluster: Putative uncharacterized protein
           NCU09449.1; n=1; Neurospora crassa|Rep: Putative
           uncharacterized protein NCU09449.1 - Neurospora crassa
          Length = 1059

 Score = 34.3 bits (75), Expect = 2.5
 Identities = 23/65 (35%), Positives = 33/65 (50%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +QH Q +Q +   P     QH      QH  PLL +Q+  H L+QQ+ Q + Q  +QQ +
Sbjct: 31  QQHQQHQQQQPPHPQ--YSQHPPPPPPQHPQPLLQRQQSYH-LQQQQHQHQQQ--QQQQQ 85

Query: 258 LHRGY 244
            H  Y
Sbjct: 86  HHPAY 90


>UniRef50_P48998 Cluster: Involucrin; n=3; Rattus norvegicus|Rep:
           Involucrin - Rattus norvegicus (Rat)
          Length = 568

 Score = 34.3 bits (75), Expect = 2.5
 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 1/46 (2%)
 Frame = -1

Query: 450 HMGSRQHMQQEQG-ECREPLAGLEQHQHSMAKQHRMPLLGQQEVPH 316
           H+G +QH +Q+Q  E  EP   L + QH   ++  +  LG+Q+ PH
Sbjct: 303 HLGEQQHQEQQQHQESCEPELHLGKQQHQETQESELQ-LGKQQKPH 347


>UniRef50_UPI0001553704 Cluster: PREDICTED: hypothetical protein;
           n=1; Mus musculus|Rep: PREDICTED: hypothetical protein -
           Mus musculus
          Length = 175

 Score = 33.9 bits (74), Expect = 3.3
 Identities = 18/69 (26%), Positives = 37/69 (53%)
 Frame = -1

Query: 462 EVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRV 283
           E L+ +  ++ ++++     E L  LEQH+  + +Q   P   +++    LE+Q+ Q+  
Sbjct: 95  EQLEQLEEQEQLEEQLEHQEEQLEHLEQHEEQLEQQEEHPEQHEEQQEEQLEEQE-QQEE 153

Query: 282 QL*EQQMEL 256
           QL  Q+ +L
Sbjct: 154 QLEHQEEQL 162


>UniRef50_UPI0000F21390 Cluster: PREDICTED: hypothetical protein; n=1;
            Danio rerio|Rep: PREDICTED: hypothetical protein - Danio
            rerio
          Length = 2027

 Score = 33.9 bits (74), Expect = 3.3
 Identities = 20/76 (26%), Positives = 38/76 (50%), Gaps = 1/76 (1%)
 Frame = -1

Query: 456  LDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQK-VQRRVQ 280
            L+  G +Q  QQ+Q + ++     +QHQ     Q +     QQ+   + +QQ+ +Q++ Q
Sbjct: 1312 LEKSGVQQQHQQQQQQHQQQQQQSQQHQQQQHHQQQQSQQQQQKAQQIQQQQQSLQQQQQ 1371

Query: 279  L*EQQMELHRGYGRSE 232
              +QQM     + R +
Sbjct: 1372 QQQQQMPPQSSHSRHQ 1387


>UniRef50_UPI00006DC8E1 Cluster: hypothetical protein
           CdifQ_04002168; n=1; Clostridium difficile
           QCD-32g58|Rep: hypothetical protein CdifQ_04002168 -
           Clostridium difficile QCD-32g58
          Length = 161

 Score = 33.9 bits (74), Expect = 3.3
 Identities = 13/32 (40%), Positives = 13/32 (40%)
 Frame = +2

Query: 293 CTFCCSNRCGTSCCPSSGILCCFAILCWCCSN 388
           C  CC N C   CC   G   C    C CC N
Sbjct: 129 CNDCCCNNCSNCCCNDCG---CKDCCCNCCKN 157


>UniRef50_UPI0000611EB5 Cluster: Proline rich 9.; n=2; Gallus
           gallus|Rep: Proline rich 9. - Gallus gallus
          Length = 119

 Score = 33.9 bits (74), Expect = 3.3
 Identities = 17/52 (32%), Positives = 20/52 (38%)
 Frame = +2

Query: 266 CCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCS 421
           CCS  C   C+  CS +C T C       C    +   CS   S     PCS
Sbjct: 55  CCSTQCVEPCSTQCSTQCVTQCVEPCSTQCVTQCV-EPCSTQCSTQCVEPCS 105



 Score = 32.3 bits (70), Expect = 10.0
 Identities = 23/75 (30%), Positives = 26/75 (34%), Gaps = 2/75 (2%)
 Frame = +2

Query: 269 CSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCS--CCICCRL 442
           C   C   CT CCS +C   C       C    +   CS         PCS  C   C  
Sbjct: 44  CQNPCASECTTCCSTQCVEPCSTQCSTQCVTQCV-EPCSTQCVTQCVEPCSTQCSTQCVE 102

Query: 443 PIWSSTSSTFPVWIC 487
           P  S+  ST  V  C
Sbjct: 103 PC-STQCSTQCVTQC 116


>UniRef50_Q102G1 Cluster: Progranulin; n=2; Oreochromis
           mossambicus|Rep: Progranulin - Oreochromis mossambicus
           (Mozambique tilapia) (Tilapia mossambica)
          Length = 206

 Score = 33.9 bits (74), Expect = 3.3
 Identities = 15/43 (34%), Positives = 18/43 (41%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCC 382
           C+  C   S       CC  + G  CCP    +CC A L  CC
Sbjct: 20  CSITCPDGSTCSDTATCCKAKIGFGCCPFPHAMCC-ADLLHCC 61


>UniRef50_A2A5X5 Cluster: Ortholog of keratin associated protein
           16-1 KRTAP16-1; n=7; Murinae|Rep: Ortholog of keratin
           associated protein 16-1 KRTAP16-1 - Mus musculus (Mouse)
          Length = 502

 Score = 33.9 bits (74), Expect = 3.3
 Identities = 29/89 (32%), Positives = 39/89 (43%), Gaps = 5/89 (5%)
 Frame = +2

Query: 248 PLC-NSICCSYSCTL-RCTFCC-SNRCGTSCC-PSSGI-LCCFAILCWCCSNPASGSLHS 412
           P+C  S C S +  L  C   C S+ CG+ CC PS  +  CC  + C       S S+ S
Sbjct: 28  PVCLPSSCRSQTWQLVTCEDSCGSSGCGSQCCQPSCSVSSCCQPVCCEATICEPSCSV-S 86

Query: 413 PCSCCICCRLPIWSSTSSTFPVWICTSVC 499
            C+  +CC   I   + S      C  VC
Sbjct: 87  SCAQPVCCEATICEPSCSMGS--CCQPVC 113


>UniRef50_Q8ZRX7 Cluster: Putative viral protein; n=1; Salmonella
           typhimurium|Rep: Putative viral protein - Salmonella
           typhimurium
          Length = 115

 Score = 33.9 bits (74), Expect = 3.3
 Identities = 19/52 (36%), Positives = 24/52 (46%), Gaps = 4/52 (7%)
 Frame = +2

Query: 305 CSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCS----CCICCRLPI 448
           C NR    CC  +G   C  I+C C     +GSL+  C+      ICC L I
Sbjct: 66  CFNRLAFLCCSEAG---CGPIVCACLKEKEAGSLYRDCNSYYIVLICCFLLI 114


>UniRef50_A1H7M9 Cluster: Uncharacterized protein possibly involved
           in aromatic compounds catabolism-like; n=4;
           Ralstonia|Rep: Uncharacterized protein possibly involved
           in aromatic compounds catabolism-like - Ralstonia
           pickettii 12J
          Length = 498

 Score = 33.9 bits (74), Expect = 3.3
 Identities = 15/36 (41%), Positives = 21/36 (58%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMP 343
           H+ +RQ   Q Q   R+ +AG  QH H + +Q RMP
Sbjct: 126 HVFTRQVALQRQRFMRDGVAGARQHHHRIGQQRRMP 161


>UniRef50_Q9VUB7 Cluster: CG32133-PA; n=1; Drosophila
            melanogaster|Rep: CG32133-PA - Drosophila melanogaster
            (Fruit fly)
          Length = 2294

 Score = 33.9 bits (74), Expect = 3.3
 Identities = 17/65 (26%), Positives = 39/65 (60%)
 Frame = -1

Query: 456  LDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL 277
            L ++  +Q MQ++Q + ++     +Q Q    +Q +  L+GQQ+   L++QQ+  ++ Q+
Sbjct: 1150 LQYLQQQQLMQKQQQQQQQQ----QQQQQQQQQQQQQQLVGQQQQQILIQQQQTPQQQQI 1205

Query: 276  *EQQM 262
             +Q++
Sbjct: 1206 LQQKL 1210


>UniRef50_Q54D50 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 717

 Score = 33.9 bits (74), Expect = 3.3
 Identities = 18/60 (30%), Positives = 36/60 (60%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ+Q + ++ L  + + Q  +  Q  M    QQ +P + EQQ++Q+++Q  +QQ++
Sbjct: 144 QQQQQQQQQQQQQLLPQMYEQQQQLLPQ--MYEQQQQSLPQMYEQQQLQQQLQQIQQQLQ 201



 Score = 33.1 bits (72), Expect = 5.7
 Identities = 26/111 (23%), Positives = 56/111 (50%)
 Frame = -1

Query: 591 YFIHQYKLLSTNKSFVLSLCRKALCSFSSIEQTLVQIHTGNVLEVLDHMGSRQHMQQEQG 412
           Y  H Y   S N  +  +   +    +  +E  + Q+ T ++++V  H   +  +QQ+Q 
Sbjct: 32  YHPHHYYRTSCNPQY--NSQNQHETQYQKVELQICQLGT-SLIDV-SH-NKQNDLQQQQQ 86

Query: 411 ECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           + ++ L  L+Q    + +Q ++P L +Q+     +QQ+ Q++ Q  +QQ +
Sbjct: 87  QEQQQLQQLQQKLQQL-QQQQLPQLNEQQQQQQQQQQQQQQQQQQQQQQQQ 136



 Score = 32.3 bits (70), Expect = 10.0
 Identities = 23/81 (28%), Positives = 45/81 (55%)
 Frame = -1

Query: 501 EQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEV 322
           +Q+L Q++     + L HM  +Q  QQ+Q   ++PL  +++ Q        +PL+ +Q+ 
Sbjct: 273 QQSLQQMNDQQ--QSLPHMYDQQQQQQQQ---QQPLPQMDEQQS-------LPLMYEQQQ 320

Query: 321 PHLLEQQKVQRRVQL*EQQME 259
            H  +QQ+ Q++ Q  +QQ +
Sbjct: 321 HHQQQQQQQQQQQQQQQQQQQ 341


>UniRef50_Q22XN6 Cluster: Thioredoxin family protein; n=2;
           Alveolata|Rep: Thioredoxin family protein - Tetrahymena
           thermophila SB210
          Length = 416

 Score = 33.9 bits (74), Expect = 3.3
 Identities = 20/75 (26%), Positives = 38/75 (50%), Gaps = 3/75 (4%)
 Frame = -1

Query: 471 NVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLL---GQQEVPHLLEQQ 301
           N  E  D     Q + +E+ + +E    + QH+ ++ +QHR  LL    Q+E   L  QQ
Sbjct: 146 NPQEANDDQAKAQQLNEEEQKLKEQEELIRQHEEAIERQHREQLLLLQRQEEEDRLRRQQ 205

Query: 300 KVQRRVQL*EQQMEL 256
           + + R++  ++  E+
Sbjct: 206 EERIRLEAEQKLREI 220


>UniRef50_Q0E901 Cluster: CG30389-PA, isoform A; n=6; Coelomata|Rep:
            CG30389-PA, isoform A - Drosophila melanogaster (Fruit
            fly)
          Length = 980

 Score = 33.9 bits (74), Expect = 3.3
 Identities = 18/61 (29%), Positives = 26/61 (42%)
 Frame = -1

Query: 462  EVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRV 283
            E   H   +QH Q +Q +  +     +Q QH   +QH+     QQ   H   QQ  Q + 
Sbjct: 847  EYQQHQQHQQHQQHQQHQQHQQHQQHQQQQHQQHQQHQQQQHQQQHQQHQQHQQHQQHQQ 906

Query: 282  Q 280
            Q
Sbjct: 907  Q 907


>UniRef50_A0DGM1 Cluster: Chromosome undetermined scaffold_5, whole
           genome shotgun sequence; n=4; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_5,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 667

 Score = 33.9 bits (74), Expect = 3.3
 Identities = 20/60 (33%), Positives = 32/60 (53%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ+Q +C +    LEQ Q    +Q +   L QQ+     +QQ+ Q++ Q  +QQ E
Sbjct: 588 QQQQQQQQQQCEQEK--LEQQQEQEQEQQQAQELQQQQQQQQQQQQQQQQQEQEQQQQQE 645



 Score = 32.7 bits (71), Expect = 7.5
 Identities = 19/59 (32%), Positives = 29/59 (49%)
 Frame = -1

Query: 435 QHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           Q  QQEQ E  +     EQ Q     + +  LL QQ+     EQQ+ +++ Q  +QQ +
Sbjct: 534 QEQQQEQQEQLQQQQQYEQQQQKQEHEQQQLLLQQQQQQQQYEQQQNEQQQQQQQQQQQ 592


>UniRef50_A0C549 Cluster: Chromosome undetermined scaffold_15, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_15,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 728

 Score = 33.9 bits (74), Expect = 3.3
 Identities = 21/95 (22%), Positives = 44/95 (46%)
 Frame = -1

Query: 543 LSLCRKALCSFSSIEQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSM 364
           L++ +  +  +S + Q+L+Q      +  L      Q  QQ+Q + ++     +Q Q   
Sbjct: 388 LNIGKSLIQKYSELLQSLIQKIAVERMSCLPEDTDEQQQQQQQQQQQQQQQQQQQQQQQQ 447

Query: 363 AKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
            +Q +     QQ+     +QQ+ Q++ Q  +QQ +
Sbjct: 448 QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ 482


>UniRef50_Q7SEI9 Cluster: Predicted protein; n=1; Neurospora
           crassa|Rep: Predicted protein - Neurospora crassa
          Length = 609

 Score = 33.9 bits (74), Expect = 3.3
 Identities = 29/132 (21%), Positives = 55/132 (41%)
 Frame = -1

Query: 600 PKLYFIHQYKLLSTNKSFVLSLCRKALCSFSSIEQTLVQIHTGNVLEVLDHMGSRQHMQQ 421
           P  + +H   LLS +  +  S C   LC      Q L Q    +  ++   +G +Q  QQ
Sbjct: 110 PGDFVLHALFLLSNHAGY--SQCSCDLCCKMIESQKLRQTDQQHAQKIQQVLGQKQRQQQ 167

Query: 420 EQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELHRGYG 241
            + +        ++ Q    K+H      QQ+     +QQ+ Q++ Q  +Q  ++ +   
Sbjct: 168 IEQQ--------QKQQEQQQKEHEQQQQQQQQQQQQQQQQQQQQQQQQQQQNQQMQQMQQ 219

Query: 240 RSEGRCCYQRTQ 205
             + +   Q+TQ
Sbjct: 220 AQQAQQIMQQTQ 231


>UniRef50_Q4WMY7 Cluster: Putative uncharacterized protein; n=3;
           Trichocomaceae|Rep: Putative uncharacterized protein -
           Aspergillus fumigatus (Sartorya fumigata)
          Length = 356

 Score = 33.9 bits (74), Expect = 3.3
 Identities = 14/28 (50%), Positives = 16/28 (57%)
 Frame = +2

Query: 257 NSICCSYSCTLRCTFCCSNRCGTSCCPS 340
           N +CC   C   CT CC  RC + CCPS
Sbjct: 68  NCLCCGIQC---CTGCC--RCCSCCCPS 90


>UniRef50_A6SKS7 Cluster: Putative uncharacterized protein; n=2;
           Sclerotiniaceae|Rep: Putative uncharacterized protein -
           Botryotinia fuckeliana B05.10
          Length = 779

 Score = 33.9 bits (74), Expect = 3.3
 Identities = 15/48 (31%), Positives = 25/48 (52%)
 Frame = -1

Query: 435 QHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQ 292
           Q +Q +Q + ++P   L+Q Q    +QH   +L QQ+     +QQ  Q
Sbjct: 334 QQVQAQQAQTQQPSGALQQQQQQQQQQHAAAMLQQQQQQQQQQQQTRQ 381


>UniRef50_P13709 Cluster: Homeotic protein female sterile; n=4;
            Drosophila melanogaster|Rep: Homeotic protein female
            sterile - Drosophila melanogaster (Fruit fly)
          Length = 2038

 Score = 33.9 bits (74), Expect = 3.3
 Identities = 18/63 (28%), Positives = 34/63 (53%)
 Frame = -1

Query: 438  RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
            +QH QQ+Q +  +     +QHQ    +Q +   L QQ++    +QQ+ Q+ +Q  + Q +
Sbjct: 1509 QQHHQQQQQQTHQQQ---QQHQQQHHQQQQQQQLTQQQLQQQQQQQQQQQHLQQQQHQQQ 1565

Query: 258  LHR 250
             H+
Sbjct: 1566 HHQ 1568


>UniRef50_UPI000155D188 Cluster: PREDICTED: similar to TatD DNase
           domain-containing deoxyribonuclease 2; n=1;
           Ornithorhynchus anatinus|Rep: PREDICTED: similar to TatD
           DNase domain-containing deoxyribonuclease 2 -
           Ornithorhynchus anatinus
          Length = 620

 Score = 33.5 bits (73), Expect = 4.3
 Identities = 25/74 (33%), Positives = 32/74 (43%), Gaps = 10/74 (13%)
 Frame = +2

Query: 254 CNSICC-SYSCTLRCTFCCSNRCGTSC-----CPSSGILCCFAILCWC---CSNPASGSL 406
           C+S C  +  C+  C   CS  CG+SC     C S+    C    C C   C +  SG+ 
Sbjct: 77  CDSSCSGTCGCSGTCGSSCSGTCGSSCSGTCDCSSTCDSSCSG-TCDCSGTCDSSCSGTC 135

Query: 407 HSPCSC-CICCRLP 445
            S CS  C   R P
Sbjct: 136 DSSCSSDCSRSRYP 149


>UniRef50_UPI0000E49085 Cluster: PREDICTED: similar to keratin
           associated protein; n=1; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to keratin associated
           protein - Strongylocentrotus purpuratus
          Length = 130

 Score = 33.5 bits (73), Expect = 4.3
 Identities = 21/67 (31%), Positives = 29/67 (43%), Gaps = 2/67 (2%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCG--TSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           C S     S + R    C +  G  + CC S+ +  CF +L  CC  PA G + + C   
Sbjct: 62  CRSAIGLMSASCRLVSSCRSAIGRLSVCCQSAVV--CFRLLSVCC-RPAIGLMSASCRLV 118

Query: 428 ICCRLPI 448
             CR  I
Sbjct: 119 SSCRSAI 125


>UniRef50_UPI0000E47460 Cluster: PREDICTED: hypothetical protein; n=2;
            Strongylocentrotus purpuratus|Rep: PREDICTED:
            hypothetical protein - Strongylocentrotus purpuratus
          Length = 2304

 Score = 33.5 bits (73), Expect = 4.3
 Identities = 18/72 (25%), Positives = 33/72 (45%)
 Frame = -1

Query: 450  HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*E 271
            H+G  Q  +  Q + ++     +QHQ    +Q +     QQ+     +QQ+ Q + Q  +
Sbjct: 1471 HIGGEQQARLHQHQQQQQQQQQQQHQQQQQQQQQQQQQQQQQQHQQQQQQQQQHQQQQQQ 1530

Query: 270  QQMELHRGYGRS 235
            QQ +  + Y  S
Sbjct: 1531 QQQQQQQAYTSS 1542


>UniRef50_Q4T8W5 Cluster: Chromosome undetermined SCAF7713, whole
            genome shotgun sequence; n=18; Eukaryota|Rep: Chromosome
            undetermined SCAF7713, whole genome shotgun sequence -
            Tetraodon nigroviridis (Green puffer)
          Length = 1170

 Score = 33.5 bits (73), Expect = 4.3
 Identities = 24/62 (38%), Positives = 30/62 (48%)
 Frame = +2

Query: 230  PSLLP*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLH 409
            PSL P  LC S+C S  C   C   CS+ C  S CPS     C ++    CS+P    L+
Sbjct: 1045 PSLWP-SLCPSLCSSL-CPSLCPSLCSSLC-PSLCPS----LCPSLWPSLCSSPCILHLY 1097

Query: 410  SP 415
             P
Sbjct: 1098 PP 1099


>UniRef50_Q08B86 Cluster: Zgc:154176; n=5; Clupeocephala|Rep:
           Zgc:154176 - Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 292

 Score = 33.5 bits (73), Expect = 4.3
 Identities = 21/74 (28%), Positives = 27/74 (36%), Gaps = 14/74 (18%)
 Frame = +2

Query: 269 CSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAIL------CWCCSNPASGSL-------- 406
           C +S   +C  CC+   G      SG+  C A        CW C +     +        
Sbjct: 125 CYHSGCFQCRQCCAPLAGRQYYSRSGLPLCEACHQASLEPCWACGDVIKDHVIRALERAY 184

Query: 407 HSPCSCCICCRLPI 448
           H PC  C  CR PI
Sbjct: 185 HPPCFVCTTCRQPI 198


>UniRef50_O93321 Cluster: All-1 related protein; n=2; Takifugu
            rubripes|Rep: All-1 related protein - Fugu rubripes
            (Japanese pufferfish) (Takifugu rubripes)
          Length = 4823

 Score = 33.5 bits (73), Expect = 4.3
 Identities = 17/60 (28%), Positives = 32/60 (53%)
 Frame = -1

Query: 384  EQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELHRGYGRSEGRCCYQRTQ 205
            +Q Q  + +Q +   L QQ+    L QQ+ Q+++QL +QQ +L +     +    +Q+ Q
Sbjct: 3079 QQQQQQLHQQQQQQQLHQQQQQQQLHQQQQQQQLQLQQQQQQLQQQQNVDKNMIQFQQQQ 3138


>UniRef50_Q0JLD3 Cluster: Os01g0607400 protein; n=16;
           Magnoliophyta|Rep: Os01g0607400 protein - Oryza sativa
           subsp. japonica (Rice)
          Length = 971

 Score = 33.5 bits (73), Expect = 4.3
 Identities = 21/70 (30%), Positives = 36/70 (51%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*E 271
           HM +R+  QQ+Q + + P    +Q QH   +Q  +    QQ+     +QQ+ Q++ Q  +
Sbjct: 178 HMKARE--QQQQQQQQPPQQRQQQPQHIQMQQMLLQRAAQQQQQQQQQQQQQQQQQQQQQ 235

Query: 270 QQMELHRGYG 241
           QQ +  R  G
Sbjct: 236 QQQQQQRRDG 245


>UniRef50_Q9W483 Cluster: CG15772-PA; n=2; Sophophora|Rep:
           CG15772-PA - Drosophila melanogaster (Fruit fly)
          Length = 259

 Score = 33.5 bits (73), Expect = 4.3
 Identities = 18/58 (31%), Positives = 30/58 (51%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQ 265
           +QH QQ+  + ++     +QHQ    +Q +     QQ+  HL +QQ  Q + Q  +QQ
Sbjct: 37  QQHQQQQHQQHQQQQHQQQQHQQHQQQQQQQHQHQQQQQQHLQQQQHHQLQQQQQQQQ 94


>UniRef50_Q9GSL4 Cluster: ZFH-2; n=1; Trichinella spiralis|Rep:
           ZFH-2 - Trichinella spiralis (Trichina worm)
          Length = 1021

 Score = 33.5 bits (73), Expect = 4.3
 Identities = 14/45 (31%), Positives = 26/45 (57%)
 Frame = -1

Query: 459 VLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQE 325
           V DH+ ++QH+ + +    EP+  ++QHQH   +Q +     QQ+
Sbjct: 741 VQDHVFTKQHIDRVKIAVGEPVDEIQQHQHQQQQQQQQQQQQQQQ 785


>UniRef50_Q7REV3 Cluster: Drosophila melanogaster CG8797 gene
           product-related; n=8; Eukaryota|Rep: Drosophila
           melanogaster CG8797 gene product-related - Plasmodium
           yoelii yoelii
          Length = 2198

 Score = 33.5 bits (73), Expect = 4.3
 Identities = 18/58 (31%), Positives = 32/58 (55%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQ 265
           +Q  QQ+Q E ++     +Q Q  + +  +     QQEV  + +QQ+ Q++ QL +QQ
Sbjct: 645 QQQQQQQQQEVQQIQQQQQQQQQEVQQIQQQQQQQQQEVQQIQQQQQQQQQQQLQQQQ 702



 Score = 32.7 bits (71), Expect = 7.5
 Identities = 17/60 (28%), Positives = 34/60 (56%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q +QQ Q + ++    ++Q Q    +Q +  L  QQ++    +QQ+ Q++ QL +QQ +
Sbjct: 666 QQEVQQIQQQQQQQQQEVQQIQQQQQQQQQQQLQQQQQLQQQQQQQQQQQQQQLQQQQQQ 725


>UniRef50_Q6T872 Cluster: DIF insensitive mutant A; n=2;
           Dictyostelium discoideum|Rep: DIF insensitive mutant A -
           Dictyostelium discoideum (Slime mold)
          Length = 1227

 Score = 33.5 bits (73), Expect = 4.3
 Identities = 20/66 (30%), Positives = 35/66 (53%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*E 271
           H   +QH Q +Q + ++     +QHQH   +Q +     QQ+     +QQ+ Q++ QL +
Sbjct: 223 HQQHQQHQQHQQQQQQQQQQQQQQHQHQQQQQQQQQ---QQQ-----QQQQQQQQQQLKQ 274

Query: 270 QQMELH 253
           QQ + H
Sbjct: 275 QQPQQH 280



 Score = 33.1 bits (72), Expect = 5.7
 Identities = 17/60 (28%), Positives = 32/60 (53%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ+Q + ++     +QHQ    +Q +     QQ+  H  +QQ+ Q++ Q  +QQ +
Sbjct: 209 QQQQQQQQQQQQQQHQQHQQHQQHQQQQQQQQQQQQQQHQHQQQQQQQQQQQQQQQQQQQ 268


>UniRef50_Q556F5 Cluster: C2H2 type Zn finger-containing protein;
           n=1; Dictyostelium discoideum AX4|Rep: C2H2 type Zn
           finger-containing protein - Dictyostelium discoideum AX4
          Length = 774

 Score = 33.5 bits (73), Expect = 4.3
 Identities = 22/68 (32%), Positives = 34/68 (50%), Gaps = 2/68 (2%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGL--EQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQ 265
           +Q  QQ+Q   R P + L  +Q Q    +QH+  +  QQ      +QQ+ Q++ Q  +QQ
Sbjct: 320 QQQQQQQQMNNRVPTSLLFQQQQQQQQQQQHQQQIQQQQYQQQQQQQQQHQQQQQQQQQQ 379

Query: 264 MELHRGYG 241
              HR  G
Sbjct: 380 QLHHRTSG 387


>UniRef50_Q54ZP4 Cluster: Putative uncharacterized protein dyrk1;
           n=2; Dictyostelium discoideum|Rep: Putative
           uncharacterized protein dyrk1 - Dictyostelium discoideum
           AX4
          Length = 836

 Score = 33.5 bits (73), Expect = 4.3
 Identities = 23/88 (26%), Positives = 40/88 (45%)
 Frame = -1

Query: 507 SIEQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQ 328
           SI+      H   V         +Q  QQ Q + ++     +Q QH + +Q +  LL QQ
Sbjct: 17  SIDLIKTYKHINQVYYTAKAKKKQQAQQQAQQQAQQLQQQAQQQQHQLQQQQQ--LLQQQ 74

Query: 327 EVPHLLEQQKVQRRVQL*EQQMELHRGY 244
           +     +QQ+ Q++ Q  +QQ +  + Y
Sbjct: 75  QQQQQQQQQQQQQQQQQQQQQQQQQQQY 102


>UniRef50_Q54PJ4 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 1458

 Score = 33.5 bits (73), Expect = 4.3
 Identities = 19/69 (27%), Positives = 36/69 (52%)
 Frame = -1

Query: 465 LEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRR 286
           ++VL+ +  +Q  QQEQ + ++     +Q Q    +Q +     QQ+     +QQ+ Q++
Sbjct: 454 IKVLEKVVEKQEEQQEQQQQQQEQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ 513

Query: 285 VQL*EQQME 259
            Q  +QQ E
Sbjct: 514 QQQQQQQEE 522



 Score = 32.3 bits (70), Expect = 10.0
 Identities = 26/112 (23%), Positives = 54/112 (48%), Gaps = 1/112 (0%)
 Frame = -1

Query: 582 HQYKLLSTNKSFVLSLCRKALCSFSSIEQTLVQIHTGNVLE-VLDHMGSRQHMQQEQGEC 406
           + +K+ +TN+  V     + L + S+ +    +     VLE V++    +Q  QQ+Q E 
Sbjct: 420 YSFKVKATNRFGVGETSEELLVNSSNFKPPSPK--EIKVLEKVVEKQEEQQEQQQQQQEQ 477

Query: 405 REPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELHR 250
           ++     +Q Q    +Q +     QQ+     +QQ+ Q++ Q  E++++  R
Sbjct: 478 QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQEEEEIQNER 529


>UniRef50_Q54K82 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 382

 Score = 33.5 bits (73), Expect = 4.3
 Identities = 24/88 (27%), Positives = 43/88 (48%), Gaps = 8/88 (9%)
 Frame = -1

Query: 498 QTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQH---SMAKQHRMPLL--- 337
           Q L Q+      +       +Q  QQ+Q + ++    ++QHQH    + +QHR   L   
Sbjct: 167 QLLQQLQQRQQQQQQQQQQQQQQQQQQQQQQQQLQMQIQQHQHRQMQIQQQHRQMQLHQQ 226

Query: 336 --GQQEVPHLLEQQKVQRRVQL*EQQME 259
              QQ++  L +QQ+ Q++ Q  +QQ +
Sbjct: 227 MQQQQQLQQLQQQQQQQQQQQQQQQQQQ 254


>UniRef50_Q3YL58 Cluster: Mantle gene 8; n=1; Pinctada fucata|Rep:
           Mantle gene 8 - Pinctada fucata (Pearl oyster)
          Length = 223

 Score = 33.5 bits (73), Expect = 4.3
 Identities = 26/70 (37%), Positives = 30/70 (42%), Gaps = 7/70 (10%)
 Frame = -2

Query: 446 WVAGSICSRSRESVGSRWQD-------WSSTSIVWRSSIGCRYWGSKRCRTYWSSKRCSV 288
           W+ GS  S S  S GSR+         WS  S  W SS     W S R    WSS R S 
Sbjct: 22  WLFGS--SSSSSSWGSRYSSPSSFSTRWSRYSPSWSSSRYTPSWSSSRYTPSWSSSRYSP 79

Query: 287 GCSYRSSKWS 258
             S   S++S
Sbjct: 80  SWSSSRSRFS 89


>UniRef50_Q17316 Cluster: Putative uncharacterized protein; n=1;
           Ceratitis capitata|Rep: Putative uncharacterized protein
           - Ceratitis capitata (Mediterranean fruit fly)
          Length = 356

 Score = 33.5 bits (73), Expect = 4.3
 Identities = 22/80 (27%), Positives = 40/80 (50%), Gaps = 1/80 (1%)
 Frame = -1

Query: 441 SRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL-*EQQ 265
           + QHMQQ+Q + +      +Q Q    +Q +     QQ+  H  E+ K +R++ +  +++
Sbjct: 139 AHQHMQQQQQQQQ------QQQQQQQQQQQQQQQQQQQQQQHTKEKLKSERKMSVCKKEE 192

Query: 264 MELHRGYGRSEGRCCYQRTQ 205
               RG G S G+    RT+
Sbjct: 193 SSSKRGAGNSNGQNFNSRTE 212


>UniRef50_A7SLJ5 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 748

 Score = 33.5 bits (73), Expect = 4.3
 Identities = 18/67 (26%), Positives = 35/67 (52%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*E 271
           H+   +  QQ++ +  +   G +Q Q     Q R  L  +Q+  HL +QQ+ Q++ Q  +
Sbjct: 231 HLQQHRQQQQQRLDRHQQQQGQQQQQQQQRLQQRRQLRERQQ-RHLQQQQQRQQQFQRQQ 289

Query: 270 QQMELHR 250
           QQ ++ +
Sbjct: 290 QQQQMQQ 296


>UniRef50_A7SE38 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 167

 Score = 33.5 bits (73), Expect = 4.3
 Identities = 24/88 (27%), Positives = 34/88 (38%), Gaps = 3/88 (3%)
 Frame = +2

Query: 251 LCNSICCSYSCT-LRCTFCCSNRCGTSCCPS--SGILCCFAILCWCCSNPASGSLHSPCS 421
           +C  +C  Y C+ +   + CSN      C +  S  LC      + CSN  S  L   C 
Sbjct: 15  ICVQMCSIYLCSNVFSIYLCSNVFSIYLCSNVFSIYLCSNVFSIYLCSNVFSIYLVFKCV 74

Query: 422 CCICCRLPIWSSTSSTFPVWICTSVCSI 505
               C         S   V+IC  +CS+
Sbjct: 75  SIYLCSNVFSIYLCSNVLVYICVQMCSV 102


>UniRef50_A7S8Y9 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 123

 Score = 33.5 bits (73), Expect = 4.3
 Identities = 17/60 (28%), Positives = 24/60 (40%)
 Frame = +2

Query: 251 LCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCI 430
           LC S  C    +  C  C SN C   C  ++ +LC       C SN     + + C  C+
Sbjct: 5   LCVSNTCVLCVSNTCVLCVSNTC-VLCVSNTCVLCVSNTCVLCVSNTCVLCVSNTCVLCV 63



 Score = 33.5 bits (73), Expect = 4.3
 Identities = 17/60 (28%), Positives = 24/60 (40%)
 Frame = +2

Query: 251 LCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCI 430
           LC S  C    +  C  C SN C   C  ++ +LC       C SN     + + C  C+
Sbjct: 13  LCVSNTCVLCVSNTCVLCVSNTC-VLCVSNTCVLCVSNTCVLCVSNTCVLCVSNTCVLCV 71



 Score = 33.5 bits (73), Expect = 4.3
 Identities = 17/60 (28%), Positives = 24/60 (40%)
 Frame = +2

Query: 251 LCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCI 430
           LC S  C    +  C  C SN C   C  ++ +LC       C SN     + + C  C+
Sbjct: 21  LCVSNTCVLCVSNTCVLCVSNTC-VLCVSNTCVLCVSNTCVLCVSNTCVLCVSNTCVLCV 79



 Score = 33.5 bits (73), Expect = 4.3
 Identities = 17/60 (28%), Positives = 24/60 (40%)
 Frame = +2

Query: 251 LCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCI 430
           LC S  C    +  C  C SN C   C  ++ +LC       C SN     + + C  C+
Sbjct: 29  LCVSNTCVLCVSNTCVLCVSNTC-VLCVSNTCVLCVSNTCVLCVSNTCVLCVSNTCVLCV 87



 Score = 33.5 bits (73), Expect = 4.3
 Identities = 17/60 (28%), Positives = 24/60 (40%)
 Frame = +2

Query: 251 LCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCI 430
           LC S  C    +  C  C SN C   C  ++ +LC       C SN     + + C  C+
Sbjct: 45  LCVSNTCVLCVSNTCVLCVSNTC-VLCVSNTCVLCVSNTCVLCVSNTCVLCVSNTCVLCV 103



 Score = 33.5 bits (73), Expect = 4.3
 Identities = 17/60 (28%), Positives = 24/60 (40%)
 Frame = +2

Query: 251 LCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCI 430
           LC S  C    +  C  C SN C   C  ++ +LC       C SN     + + C  C+
Sbjct: 53  LCVSNTCVLCVSNTCVLCVSNTC-VLCVSNTCVLCVSNTCVLCVSNTCVLCVSNTCVLCV 111



 Score = 33.1 bits (72), Expect = 5.7
 Identities = 17/60 (28%), Positives = 24/60 (40%)
 Frame = +2

Query: 251 LCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCI 430
           LC S  C    +  C  C SN C   C  ++ +LC       C SN     + + C  C+
Sbjct: 61  LCVSNTCVLCVSNTCVLCVSNTC-VLCVSNTCVLCVSNTCVLCVSNTCVLCVGNTCVLCV 119


>UniRef50_A2FY74 Cluster: Putative uncharacterized protein; n=1;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 165

 Score = 33.5 bits (73), Expect = 4.3
 Identities = 14/33 (42%), Positives = 17/33 (51%)
 Frame = +2

Query: 305 CSNRCGTSCCPSSGILCCFAILCWCCSNPASGS 403
           CS  C  S C  S   CC +  C CCS+ +S S
Sbjct: 64  CSGSCSCSSCSCSSCSCC-SSCCSCCSSSSSSS 95


>UniRef50_A0DYG7 Cluster: Chromosome undetermined scaffold_7, whole
            genome shotgun sequence; n=1; Paramecium tetraurelia|Rep:
            Chromosome undetermined scaffold_7, whole genome shotgun
            sequence - Paramecium tetraurelia
          Length = 1135

 Score = 33.5 bits (73), Expect = 4.3
 Identities = 17/60 (28%), Positives = 33/60 (55%)
 Frame = -1

Query: 438  RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
            +Q  QQ+Q + ++ L   +  Q    +Q +     QQ+   LL+QQ+ Q++ Q  +QQ++
Sbjct: 884  QQQQQQQQYQQQQQLQQQQYQQQQQQQQQQQQQQQQQQQQQLLQQQQQQQQQQQQQQQLQ 943



 Score = 32.3 bits (70), Expect = 10.0
 Identities = 19/78 (24%), Positives = 38/78 (48%)
 Frame = -1

Query: 438  RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
            +Q  Q +Q + ++     +Q Q    +Q +  LL QQ+     +QQ+ Q + Q  +QQ +
Sbjct: 893  QQQQQLQQQQYQQQQQQQQQQQQQQQQQQQQQLLQQQQQQQQQQQQQQQLQQQQQQQQQQ 952

Query: 258  LHRGYGRSEGRCCYQRTQ 205
              +   + + +  YQ+ Q
Sbjct: 953  QQQYQQQQQQKQQYQQQQ 970


>UniRef50_A0C9C7 Cluster: Chromosome undetermined scaffold_16, whole
           genome shotgun sequence; n=4; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_16,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 397

 Score = 33.5 bits (73), Expect = 4.3
 Identities = 19/69 (27%), Positives = 33/69 (47%)
 Frame = -1

Query: 504 IEQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQE 325
           + Q + Q+ T    E  +  G + H QQE  + ++   G E+HQ+     H+ P  G + 
Sbjct: 223 VHQPIDQL-TNQHTEQQEQQGKQTHPQQEVPQQQQAPEGKEEHQNDQKGNHQHPRDGHRH 281

Query: 324 VPHLLEQQK 298
             H  +Q+K
Sbjct: 282 HQHHDDQRK 290


>UniRef50_Q6BS91 Cluster: Similarities with CA0749|CaHAP5 Candida
           albicans CaHAP5; n=8; Saccharomycetales|Rep:
           Similarities with CA0749|CaHAP5 Candida albicans CaHAP5
           - Debaryomyces hansenii (Yeast) (Torulaspora hansenii)
          Length = 393

 Score = 33.5 bits (73), Expect = 4.3
 Identities = 21/64 (32%), Positives = 34/64 (53%), Gaps = 1/64 (1%)
 Frame = -1

Query: 447 MGSRQHMQQEQGECREPLAGLEQH-QHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*E 271
           M  +Q  QQ+Q +   P     QH Q +  +QH+  L  QQ     LEQQ+++++ Q  +
Sbjct: 262 MLQQQQQQQQQQQQPPPPPQQPQHQQQAQHQQHQQQLEQQQLEQQQLEQQQLEQQQQQQQ 321

Query: 270 QQME 259
           QQ +
Sbjct: 322 QQQQ 325


>UniRef50_Q6BKL5 Cluster: Similarities with CA4511|IPF8966 Candida
           albicans IPF8966; n=1; Debaryomyces hansenii|Rep:
           Similarities with CA4511|IPF8966 Candida albicans
           IPF8966 - Debaryomyces hansenii (Yeast) (Torulaspora
           hansenii)
          Length = 682

 Score = 33.5 bits (73), Expect = 4.3
 Identities = 23/71 (32%), Positives = 36/71 (50%), Gaps = 4/71 (5%)
 Frame = -1

Query: 444 GSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL---- 277
           G  Q+ Q +Q     P A   QHQH+    H +P L   ++  L +QQ+ Q++ Q     
Sbjct: 482 GYPQNNQAQQ--LNVPPASSVQHQHNNPLIHSLPNLQVHQILQLQQQQQQQQQQQQQQQE 539

Query: 276 *EQQMELHRGY 244
            +QQ + H+GY
Sbjct: 540 QQQQQQQHQGY 550


>UniRef50_Q5KMV6 Cluster: Putative uncharacterized protein; n=1;
           Filobasidiella neoformans|Rep: Putative uncharacterized
           protein - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 936

 Score = 33.5 bits (73), Expect = 4.3
 Identities = 20/82 (24%), Positives = 39/82 (47%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*E 271
           H   +Q +QQ+Q + ++     +Q Q    +Q R P   QQ+     +QQ+ Q++ Q  +
Sbjct: 247 HQQQQQQLQQQQQQ-QQQQQQQQQQQQQQQQQQRQPQQQQQQQQQQQQQQQQQQQQQQQQ 305

Query: 270 QQMELHRGYGRSEGRCCYQRTQ 205
           QQ +  +   + +     Q+ Q
Sbjct: 306 QQQQQQQQQQQQQHAMMQQQQQ 327


>UniRef50_Q55X27 Cluster: Putative uncharacterized protein; n=1;
           Filobasidiella neoformans|Rep: Putative uncharacterized
           protein - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 1269

 Score = 33.5 bits (73), Expect = 4.3
 Identities = 20/82 (24%), Positives = 39/82 (47%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*E 271
           H   +Q +QQ+Q + ++     +Q Q    +Q R P   QQ+     +QQ+ Q++ Q  +
Sbjct: 460 HQQQQQQLQQQQQQ-QQQQQQQQQQQQQQQQQQRQPQQQQQQQQQQQQQQQQQQQQQQQQ 518

Query: 270 QQMELHRGYGRSEGRCCYQRTQ 205
           QQ +  +   + +     Q+ Q
Sbjct: 519 QQQQQQQQQQQQQHAMMQQQQQ 540


>UniRef50_Q0U994 Cluster: Putative uncharacterized protein; n=1;
            Phaeosphaeria nodorum|Rep: Putative uncharacterized
            protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 1731

 Score = 33.5 bits (73), Expect = 4.3
 Identities = 20/80 (25%), Positives = 37/80 (46%)
 Frame = -1

Query: 435  QHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMEL 256
            Q +QQ+Q   ++     +Q Q    +Q +     QQ+     +QQ+ Q++ Q  +QQM++
Sbjct: 1055 QRIQQQQQHNQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQMQM 1114

Query: 255  HRGYGRSEGRCCYQRTQCPA 196
                   + R   Q+ Q  A
Sbjct: 1115 QMQQAAQQQRAGQQQMQLAA 1134



 Score = 33.5 bits (73), Expect = 4.3
 Identities = 19/80 (23%), Positives = 39/80 (48%)
 Frame = -1

Query: 438  RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
            +QH QQ+Q + ++     +Q Q    +Q +     QQ+     +QQ+ Q+++Q+  QQ  
Sbjct: 1061 QQHNQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQMQMQMQQAA 1120

Query: 258  LHRGYGRSEGRCCYQRTQCP 199
              +  G+ + +     +Q P
Sbjct: 1121 QQQRAGQQQMQLAAMASQQP 1140


>UniRef50_Q0CRX6 Cluster: Predicted protein; n=1; Aspergillus
           terreus NIH2624|Rep: Predicted protein - Aspergillus
           terreus (strain NIH 2624)
          Length = 154

 Score = 33.5 bits (73), Expect = 4.3
 Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 2/23 (8%)
 Frame = +2

Query: 293 CTFCCS--NRCGTSCCPSSGILC 355
           CT CC+  +R GTSCCP SG +C
Sbjct: 133 CTVCCNGCSRSGTSCCP-SGAIC 154


>UniRef50_A5E351 Cluster: Putative uncharacterized protein; n=1;
           Lodderomyces elongisporus NRRL YB-4239|Rep: Putative
           uncharacterized protein - Lodderomyces elongisporus
           (Yeast) (Saccharomyces elongisporus)
          Length = 1003

 Score = 33.5 bits (73), Expect = 4.3
 Identities = 22/66 (33%), Positives = 35/66 (53%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +QH+QQ+Q +  E     +Q QH   +Q +     QQ+     +QQ+ Q++ QL +QQ  
Sbjct: 305 QQHLQQQQQQ--EQHLQQQQQQHLQQQQQQQQQQQQQQQQQQQQQQQQQQQQQL-QQQPP 361

Query: 258 LHRGYG 241
             R YG
Sbjct: 362 PLRSYG 367


>UniRef50_A5DV45 Cluster: Putative uncharacterized protein; n=1;
            Lodderomyces elongisporus NRRL YB-4239|Rep: Putative
            uncharacterized protein - Lodderomyces elongisporus
            (Yeast) (Saccharomyces elongisporus)
          Length = 1238

 Score = 33.5 bits (73), Expect = 4.3
 Identities = 22/86 (25%), Positives = 38/86 (44%)
 Frame = -1

Query: 537  LCRKALCSFSSIEQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAK 358
            L R  L   + ++Q     H   +     H   +QH QQ+Q + ++     +Q Q    +
Sbjct: 1129 LHRPQLLPVNHMQQLRQMPHIPQLSNHFPHSQQQQHQQQQQQQ-QQQQQQQQQQQQQQQQ 1187

Query: 357  QHRMPLLGQQEVPHLLEQQKVQRRVQ 280
            Q +     QQ+  HL +QQ+ Q + Q
Sbjct: 1188 QQQQQQQQQQQHQHLQQQQQQQHQHQ 1213


>UniRef50_Q01644 Cluster: Male-specific sperm protein Mst84Dc; n=14;
           Diptera|Rep: Male-specific sperm protein Mst84Dc -
           Drosophila melanogaster (Fruit fly)
          Length = 55

 Score = 33.5 bits (73), Expect = 4.3
 Identities = 23/60 (38%), Positives = 23/60 (38%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCIC 433
           C S CC Y C   C  CC   CG  C P     CC    C  C  P  G   S C  C C
Sbjct: 6   CGS-CCGYYC---CGPCC-GPCGPRCGPCGS--CCGP--CGPC-GPCCGPFGSCCGGCWC 55


>UniRef50_UPI0000F2CDA9 Cluster: PREDICTED: hypothetical protein;
           n=1; Monodelphis domestica|Rep: PREDICTED: hypothetical
           protein - Monodelphis domestica
          Length = 228

 Score = 33.1 bits (72), Expect = 5.7
 Identities = 19/85 (22%), Positives = 38/85 (44%)
 Frame = -1

Query: 513 FSSIEQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLG 334
           F ++  TL Q+      +       +Q  QQ+Q + ++     +Q Q    +Q +  L  
Sbjct: 25  FMAVLHTLTQVKKAYKQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQLQQ 84

Query: 333 QQEVPHLLEQQKVQRRVQL*EQQME 259
           QQ+     +QQ+  ++ Q  +QQ +
Sbjct: 85  QQQKQQKQQQQQQHQQQQQQQQQQQ 109


>UniRef50_UPI0000F2CAEF Cluster: PREDICTED: similar to novel KRAB
           box and zinc finger, C2H2 type domain containing
           protein; n=1; Monodelphis domestica|Rep: PREDICTED:
           similar to novel KRAB box and zinc finger, C2H2 type
           domain containing protein - Monodelphis domestica
          Length = 652

 Score = 33.1 bits (72), Expect = 5.7
 Identities = 23/87 (26%), Positives = 38/87 (43%)
 Frame = -1

Query: 606 FEPKLYFIHQYKLLSTNKSFVLSLCRKALCSFSSIEQTLVQIHTGNVLEVLDHMGSRQHM 427
           F  K Y     ++ +  K +    C KA    SS+  T  +IHTG      +  G R H+
Sbjct: 532 FTKKGYLTKHQRIHTGRKPYECKQCGKAFTERSSLA-THQRIHTGEKPYECEKCGKRIHI 590

Query: 426 QQEQGECREPLAGLEQHQHSMAKQHRM 346
           +++  EC++         H +A  HR+
Sbjct: 591 ERKIYECKQCGKAFTCRSH-LATHHRI 616


>UniRef50_UPI0000DA38DA Cluster: PREDICTED: similar to Zinc finger
           protein 500; n=1; Rattus norvegicus|Rep: PREDICTED:
           similar to Zinc finger protein 500 - Rattus norvegicus
          Length = 637

 Score = 33.1 bits (72), Expect = 5.7
 Identities = 16/60 (26%), Positives = 33/60 (55%)
 Frame = -1

Query: 435 QHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMEL 256
           Q  +Q Q + +E L  LE+H     +  ++ L   +++  L +QQ+   ++QL +Q++ L
Sbjct: 346 QEQRQLQLKLQEQLRQLEEHLEQQQQMEQLQLQQMEQLEQLQQQQQQMEQLQLEQQEVHL 405


>UniRef50_UPI0000DA37F3 Cluster: PREDICTED: similar to Zinc finger
           protein 500; n=6; Theria|Rep: PREDICTED: similar to Zinc
           finger protein 500 - Rattus norvegicus
          Length = 697

 Score = 33.1 bits (72), Expect = 5.7
 Identities = 16/60 (26%), Positives = 33/60 (55%)
 Frame = -1

Query: 435 QHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMEL 256
           Q  +Q Q + +E L  LE+H     +  ++ L   +++  L +QQ+   ++QL +Q++ L
Sbjct: 377 QEQRQLQLKLQEQLRQLEEHLEQQQQMEQLQLQQMEQLEQLQQQQQQMEQLQLEQQEVHL 436


>UniRef50_UPI0000546B3D Cluster: PREDICTED: hypothetical protein;
           n=4; Danio rerio|Rep: PREDICTED: hypothetical protein -
           Danio rerio
          Length = 749

 Score = 33.1 bits (72), Expect = 5.7
 Identities = 26/91 (28%), Positives = 34/91 (37%), Gaps = 13/91 (14%)
 Frame = +2

Query: 269 CSYSCTLRCTFCCSNRCGTSC---CPS-SGILC---CFAILCWCCSNPASGSLHSPC--- 418
           CS +CT  C+F C   C  +C   CP      C   C       CS P+S +    C   
Sbjct: 119 CSNTCTAPCSFTCPETCLKTCSETCPKPCSFTCPETCLKTCSETCSKPSSFTCPETCIKT 178

Query: 419 SCCIC---CRLPIWSSTSSTFPVWICTSVCS 502
           S  IC   C      +   +F +  C   CS
Sbjct: 179 SSDICSKPCSFTCPETCPKSFSI-TCPQTCS 208



 Score = 33.1 bits (72), Expect = 5.7
 Identities = 17/60 (28%), Positives = 23/60 (38%), Gaps = 3/60 (5%)
 Frame = +2

Query: 248 PLCNSICCSYSCTLRCTFCCSNRCGTSC---CPSSGILCCFAILCWCCSNPASGSLHSPC 418
           P   SI C  +C+  C   CS+ C   C   CP + +  C       C  P S +    C
Sbjct: 196 PKSFSITCPQTCSETCLKTCSDTCPKPCSFTCPDTYLKTCSETCSETCPKPCSFTCPESC 255


>UniRef50_UPI0000F319E5 Cluster: CDNA FLJ12547 fis, clone
           NT2RM4000634.; n=1; Bos taurus|Rep: CDNA FLJ12547 fis,
           clone NT2RM4000634. - Bos Taurus
          Length = 257

 Score = 33.1 bits (72), Expect = 5.7
 Identities = 23/89 (25%), Positives = 32/89 (35%), Gaps = 7/89 (7%)
 Frame = +2

Query: 254 CNSICCS-YSCTLRCTFCCSNRCGTSCCPSSGI------LCCFAILCWCCSNPASGSLHS 412
           C S+C   Y C   CT  C   C   C P+         +C    +C C       S+H 
Sbjct: 84  CGSVCLHVYVCACMCTCACVYMCACLCVPTCTCVHTWTSVCLNVCVCLCVCMRTCVSVHV 143

Query: 413 PCSCCICCRLPIWSSTSSTFPVWICTSVC 499
             S  +C  +  +    +   V  C SVC
Sbjct: 144 YASVYMCDCVHAYMCMPAC--VHACVSVC 170


>UniRef50_Q4SHQ6 Cluster: Chromosome 5 SCAF14581, whole genome
           shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 5
           SCAF14581, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 663

 Score = 33.1 bits (72), Expect = 5.7
 Identities = 11/22 (50%), Positives = 12/22 (54%)
 Frame = +2

Query: 317 CGTSCCPSSGILCCFAILCWCC 382
           C   CCP S   CC  + CWCC
Sbjct: 202 CWCQCCPHS---CCCYVSCWCC 220


>UniRef50_Q9DA33 Cluster: Adult male testis cDNA, RIKEN full-length
           enriched library, clone:1700021N13 product:RIKEN cDNA
           1700021N13; n=2; Mus musculus|Rep: Adult male testis
           cDNA, RIKEN full-length enriched library,
           clone:1700021N13 product:RIKEN cDNA 1700021N13 - Mus
           musculus (Mouse)
          Length = 125

 Score = 33.1 bits (72), Expect = 5.7
 Identities = 19/61 (31%), Positives = 26/61 (42%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCIC 433
           C+S  C + C L C+  C  R  +S   SS +       C     PA+ SL + C C   
Sbjct: 4   CSSSGC-FPCNL-CSCLCMMRAASSSRSSSELAAPSTCNCALLQRPATASLAAGCGCFTA 61

Query: 434 C 436
           C
Sbjct: 62  C 62


>UniRef50_A0LHU6 Cluster: Putative chromosome segregation ATPase
           precursor; n=2; Syntrophobacter fumaroxidans MPOB|Rep:
           Putative chromosome segregation ATPase precursor -
           Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
          Length = 848

 Score = 33.1 bits (72), Expect = 5.7
 Identities = 17/63 (26%), Positives = 33/63 (52%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q +QQ++ + R+     +Q Q    +Q R   + QQ      +QQ+ Q+++Q  +QQ +
Sbjct: 746 QQQLQQQKQQQRQQQMQRQQQQRQQQQQQRQQQMQQQRQRQQQQQQQRQQQMQQRQQQQQ 805

Query: 258 LHR 250
             R
Sbjct: 806 QQR 808



 Score = 32.7 bits (71), Expect = 7.5
 Identities = 17/60 (28%), Positives = 31/60 (51%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ Q + ++     +Q Q  + +Q +     QQ+    L+QQK Q+R Q  ++Q +
Sbjct: 707 QQQQQQRQQQMQQQRQQQQQRQQQLQQQRQQQRQQQQQRQQQLQQQKQQQRQQQMQRQQQ 766


>UniRef50_Q0Q5D1 Cluster: Protein kinase; n=10; BEP clade|Rep:
           Protein kinase - Triticum aestivum (Wheat)
          Length = 551

 Score = 33.1 bits (72), Expect = 5.7
 Identities = 19/56 (33%), Positives = 26/56 (46%), Gaps = 2/56 (3%)
 Frame = +2

Query: 266 CCSYSCTLRCTFCCSNRCGTSCCPSSGI--LCCFAILCWCCSNPASGSLHSPCSCC 427
           CCS+   +R   C S R G  C    G+  + C +I   CC +   GS    C+CC
Sbjct: 4   CCSWIRGIRTVKCSSIRLGCCCSWVHGLRTVKCSSIRLGCCCSWVRGS----CACC 55


>UniRef50_Q8LTG6 Cluster: Mitogen; n=1; Streptococcus phage
           phisc1|Rep: Mitogen - Streptococcus phage phisc1
          Length = 183

 Score = 33.1 bits (72), Expect = 5.7
 Identities = 22/70 (31%), Positives = 25/70 (35%), Gaps = 3/70 (4%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWC---CSNPASGSLHSPCSC 424
           C    C YSC   C  C    C  S C + G++C      WC     N   G       C
Sbjct: 107 CKCSSC-YSCPKWCRCCLWCWCDGSWCRAFGLVCWLDCF-WCGRIGCNRWRGCSSCRYRC 164

Query: 425 CICCRLPIWS 454
            ICC    WS
Sbjct: 165 GICCYCCFWS 174


>UniRef50_Q9VED3 Cluster: CG7847-PA, isoform A; n=5; Drosophila|Rep:
           CG7847-PA, isoform A - Drosophila melanogaster (Fruit
           fly)
          Length = 1186

 Score = 33.1 bits (72), Expect = 5.7
 Identities = 15/50 (30%), Positives = 24/50 (48%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQR 289
           +Q  QQ+Q   ++PL   +Q QH   +QH      Q  + H   QQ+  +
Sbjct: 666 QQQQQQQQQHQQQPLHQQQQLQHQQQQQHHQQHYQQHAIQHQQSQQQASK 715


>UniRef50_Q9TY01 Cluster: Prion-like-(Q/n-rich)-domain-bearing
           protein protein 16; n=1; Caenorhabditis elegans|Rep:
           Prion-like-(Q/n-rich)-domain-bearing protein protein 16
           - Caenorhabditis elegans
          Length = 328

 Score = 33.1 bits (72), Expect = 5.7
 Identities = 24/83 (28%), Positives = 36/83 (43%), Gaps = 8/83 (9%)
 Frame = +2

Query: 254 CNSICCSYSC-TLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGS-------LH 409
           CN+ C S +  T +C   C+N+C  SC PSS     ++     C+   SGS         
Sbjct: 166 CNNQCASQNQKTNQCANECNNQCANSCSPSSQ-TSSYSKCVSQCAEQCSGSNTSNNQQCQ 224

Query: 410 SPCSCCICCRLPIWSSTSSTFPV 478
             C    C +     ST++T P+
Sbjct: 225 QQCQSNTCGQYQSTVSTTTTTPI 247


>UniRef50_Q55CH1 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 1432

 Score = 33.1 bits (72), Expect = 5.7
 Identities = 15/64 (23%), Positives = 32/64 (50%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*E 271
           H    QH + +  +  +     +Q+ +   +QH+ P   QQ+  +  +QQ+ Q++ Q  +
Sbjct: 467 HYQDEQHHEHQYYQQTQQYQQYQQYPYQQQQQHQYPYQQQQQYTYQQQQQQQQQQQQQQQ 526

Query: 270 QQME 259
           QQ +
Sbjct: 527 QQQQ 530


>UniRef50_Q54WP5 Cluster: Putative glycosyltransferase; n=1;
            Dictyostelium discoideum AX4|Rep: Putative
            glycosyltransferase - Dictyostelium discoideum AX4
          Length = 992

 Score = 33.1 bits (72), Expect = 5.7
 Identities = 26/117 (22%), Positives = 52/117 (44%), Gaps = 3/117 (2%)
 Frame = -1

Query: 594  LYFIHQYKLLSTNKSFVLSLCRKALCSFSSIEQTLVQIHTG-NVLEVLDHMGSRQHM--Q 424
            L+F++ + L +    F+ S        F   ++ +V I    N+ +  D +     +  Q
Sbjct: 746  LHFLNTFPLFNLVVFFIDSRYLPGGVIFDFKKKDMVTIQNNFNISDQHDQLQDHSQLIQQ 805

Query: 423  QEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELH 253
             +Q E ++     +Q Q    +Q +     QQ+     +QQ+ Q++ Q  +QQ +LH
Sbjct: 806  SDQDEQQQSQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQLH 862


>UniRef50_Q54WI5 Cluster: SAP DNA-binding domain-containing protein;
            n=1; Dictyostelium discoideum AX4|Rep: SAP DNA-binding
            domain-containing protein - Dictyostelium discoideum AX4
          Length = 1009

 Score = 33.1 bits (72), Expect = 5.7
 Identities = 23/99 (23%), Positives = 47/99 (47%)
 Frame = -1

Query: 501  EQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEV 322
            +Q +VQ       +V      R+ + ++Q + ++     +Q Q    KQ    L  QQ++
Sbjct: 784  QQKVVQAQQQAQQQVQREKQQREALLRQQQQQQQQQQQQQQQQERQRKQQEA-LQKQQQI 842

Query: 321  PHLLEQQKVQRRVQL*EQQMELHRGYGRSEGRCCYQRTQ 205
              L +QQ+ Q++ Q  +QQ    +   +S+ +   Q++Q
Sbjct: 843  QQLQQQQQQQQQAQQQQQQQAQQQAQQQSQQQAQQQQSQ 881


>UniRef50_Q54VY9 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 1075

 Score = 33.1 bits (72), Expect = 5.7
 Identities = 28/94 (29%), Positives = 39/94 (41%), Gaps = 4/94 (4%)
 Frame = +2

Query: 239 LP*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWC---CSNPAS-GSL 406
           LP   CN+ C   S   +C     N C   C P+     C   L +C   CS P + G  
Sbjct: 512 LPNKPCNTNCSFDSDQGKCNTQTGN-C--ECSPNFQGKNCELPLKYCSSDCSAPLNKGFC 568

Query: 407 HSPCSCCICCRLPIWSSTSSTFPVWICTSVCSID 508
           +     C C   P +  +  + P+ +CTS CS D
Sbjct: 569 NDQTGICQC--FPNYQGSDCSLPLKVCTSDCSFD 600


>UniRef50_Q54V91 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 955

 Score = 33.1 bits (72), Expect = 5.7
 Identities = 20/60 (33%), Positives = 29/60 (48%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q +QQE  + +E L   EQ Q      +  P L  QE     EQQ+ Q + Q  +QQ +
Sbjct: 422 QQELQQELQQEQEQLRHQEQQQEQQQPSNISPRLRHQEQQRQQEQQRQQEQEQQQQQQKQ 481


>UniRef50_Q54BK4 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 2014

 Score = 33.1 bits (72), Expect = 5.7
 Identities = 20/65 (30%), Positives = 39/65 (60%), Gaps = 2/65 (3%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQ-- 265
           +Q +QQ+Q   +   A  +Q Q ++ +Q ++ L  QQ+   L++QQ+ Q++ Q  +QQ  
Sbjct: 195 QQILQQQQTYQQAQQAQHQQQQSNLQQQSQLQLQIQQQQQQLVQQQQQQQQQQQHQQQQH 254

Query: 264 MELHR 250
            +LH+
Sbjct: 255 QQLHQ 259



 Score = 32.7 bits (71), Expect = 7.5
 Identities = 23/81 (28%), Positives = 39/81 (48%)
 Frame = -1

Query: 501  EQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEV 322
            +Q   Q H    ++   H  +  +M Q Q +   P     QHQH    QH      Q + 
Sbjct: 1588 QQPQPQQHNAENIKTNMHPPASTNMPQNQNQQPPPPPPPNQHQHH--PQHLQH--AQNQA 1643

Query: 321  PHLLEQQKVQRRVQL*EQQME 259
             H+++QQ++ ++ QL +QQM+
Sbjct: 1644 HHIIQQQQLHQQ-QLHQQQMQ 1663


>UniRef50_Q23847 Cluster: Glutamine-asparagine rich protein; n=2;
           Dictyostelium discoideum|Rep: Glutamine-asparagine rich
           protein - Dictyostelium discoideum (Slime mold)
          Length = 720

 Score = 33.1 bits (72), Expect = 5.7
 Identities = 32/120 (26%), Positives = 53/120 (44%), Gaps = 2/120 (1%)
 Frame = -1

Query: 387 LEQHQHSMAKQHRMPLLGQQEVPHLLEQ-QKVQRRVQL*EQQMELHRGYGRSEGRCCYQR 211
           LEQ QH   +Q    LL QQ+  H  +Q Q+ Q++ Q  +QQ +  +   R +    YQ 
Sbjct: 533 LEQQQHQQQQQQHQQLLEQQQQQHQQQQHQQYQQQQQHQQQQHQQKQNPNRFQNN-NYQA 591

Query: 210 TQCPAGDINLCSVWRNVLRYSLSVSHVGWSNQRSSGYCWN-SCDCTRFSSNYKGSSDEYD 34
           T+    D      W      + S  +  +S Q  S YC +  C+ +  ++N     + Y+
Sbjct: 592 TE----DTTSQPYWP-----TSSNQNYQYSEQYDSQYCNDVCCEGSHTNNNNNNHDNNYN 642


>UniRef50_Q22HG6 Cluster: Mov34/MPN/PAD-1 family protein; n=1;
            Tetrahymena thermophila SB210|Rep: Mov34/MPN/PAD-1 family
            protein - Tetrahymena thermophila SB210
          Length = 2388

 Score = 33.1 bits (72), Expect = 5.7
 Identities = 18/57 (31%), Positives = 32/57 (56%)
 Frame = -1

Query: 435  QHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQ 265
            QH  Q+Q + ++    L+Q Q S  +  +   L QQ+   L+ QQ++Q++ Q  +QQ
Sbjct: 1681 QHQSQQQTQAQQQ--HLQQQQQSQKQSSQFQQLQQQQYSQLILQQQLQQQQQQRQQQ 1735


>UniRef50_A7S9V6 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 357

 Score = 33.1 bits (72), Expect = 5.7
 Identities = 14/39 (35%), Positives = 18/39 (46%), Gaps = 2/39 (5%)
 Frame = +2

Query: 293 CTFCCSNRC--GTSCCPSSGILCCFAILCWCCSNPASGS 403
           C F C  +C  GT  C    ++ C   LC C  NP S +
Sbjct: 2   CIFNCIGKCIGGTCKCVGKSLMACLRGLCKCFCNPVSAA 40


>UniRef50_A7RLU4 Cluster: Predicted protein; n=3; Eukaryota|Rep:
           Predicted protein - Nematostella vectensis
          Length = 387

 Score = 33.1 bits (72), Expect = 5.7
 Identities = 17/60 (28%), Positives = 31/60 (51%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ+Q + ++     +QHQ    +Q +     QQ+     +QQ+ Q+R Q  +QQ +
Sbjct: 279 QQQQQQQQQQQQQQQQQQQQHQQQQQQQQQQQQQQQQQQQQQQQQQQQQQRQQQQQQQQQ 338



 Score = 32.7 bits (71), Expect = 7.5
 Identities = 19/78 (24%), Positives = 38/78 (48%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ+Q + ++     +Q Q    +Q +     QQ+  H  +QQ+ Q++ Q  +QQ +
Sbjct: 259 QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQHQQQQQQQQQQQQQQQQQQQ 318

Query: 258 LHRGYGRSEGRCCYQRTQ 205
             +   + + R   Q+ Q
Sbjct: 319 QQQQQQQQQQRQQQQQQQ 336


>UniRef50_A2FSM2 Cluster: Putative uncharacterized protein; n=1;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 506

 Score = 33.1 bits (72), Expect = 5.7
 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 1/43 (2%)
 Frame = +2

Query: 302 CCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPC-SCC 427
           CC   C   CC      CCF     CC     G    PC  CC
Sbjct: 412 CCCKFCKKQCC------CCFKCFKCCCKPICKGCCFCPCDDCC 448



 Score = 32.7 bits (71), Expect = 7.5
 Identities = 14/39 (35%), Positives = 16/39 (41%)
 Frame = +2

Query: 266 CCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCC 382
           CC   C  +C  CC  +C   CC      CCF     CC
Sbjct: 412 CCCKFCKKQC--CCCFKCFKCCCKPICKGCCFCPCDDCC 448


>UniRef50_A0EHS3 Cluster: Chromosome undetermined scaffold_97, whole
            genome shotgun sequence; n=2; Paramecium tetraurelia|Rep:
            Chromosome undetermined scaffold_97, whole genome shotgun
            sequence - Paramecium tetraurelia
          Length = 2950

 Score = 33.1 bits (72), Expect = 5.7
 Identities = 25/88 (28%), Positives = 41/88 (46%), Gaps = 1/88 (1%)
 Frame = -1

Query: 465  LEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHL-LEQQKVQR 289
            LE+      +Q  Q+E+ + +E    L++ Q     + +  +  +Q+   L LEQQK Q 
Sbjct: 1308 LELQKQQAEQQKKQEEEQKEKERQLELQKEQDRQQAEEQKKIEEEQKAKELQLEQQKEQE 1367

Query: 288  RVQL*EQQMELHRGYGRSEGRCCYQRTQ 205
            R Q  EQQ +L       E +   Q+ Q
Sbjct: 1368 RQQA-EQQKKLEEEQQEKERQLELQKEQ 1394


>UniRef50_A0DWE3 Cluster: Chromosome undetermined scaffold_67, whole
           genome shotgun sequence; n=3; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_67,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 3091

 Score = 33.1 bits (72), Expect = 5.7
 Identities = 19/78 (24%), Positives = 41/78 (52%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q +QQ+  + ++P   ++Q   +  +Q + P   QQ+ P   +QQ+ Q++ Q  +QQ +
Sbjct: 668 QQQLQQQSQQQQQPQ--IQQQPQAQPQQQQQPQTEQQQQPQTDQQQQPQQQQQQPQQQNQ 725

Query: 258 LHRGYGRSEGRCCYQRTQ 205
             +   +S+     Q+ Q
Sbjct: 726 QQQQTEQSQTNAQQQQQQ 743


>UniRef50_A0D240 Cluster: Chromosome undetermined scaffold_35, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_35,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 1188

 Score = 33.1 bits (72), Expect = 5.7
 Identities = 23/88 (26%), Positives = 44/88 (50%), Gaps = 2/88 (2%)
 Frame = -1

Query: 516 SFSSIEQTLVQIHTGNVLEVLDHMGSRQHMQ--QEQGECREPLAGLEQHQHSMAKQHRMP 343
           +F++ EQ   QI   N  E+++    +Q  Q  Q+Q + ++     +Q Q    +Q +  
Sbjct: 505 NFNNKEQQKDQIQQ-NEKEIIEQQQKQQQQQLEQQQQQQQQQQQQQQQQQQQQQQQQQQQ 563

Query: 342 LLGQQEVPHLLEQQKVQRRVQL*EQQME 259
              QQ+     +QQ+ Q++ QL +QQ +
Sbjct: 564 QQQQQQQQQQQQQQQQQQQQQLQQQQQQ 591


>UniRef50_A0BBG4 Cluster: Chromosome undetermined scaffold_1, whole
            genome shotgun sequence; n=3; Paramecium tetraurelia|Rep:
            Chromosome undetermined scaffold_1, whole genome shotgun
            sequence - Paramecium tetraurelia
          Length = 1319

 Score = 33.1 bits (72), Expect = 5.7
 Identities = 21/84 (25%), Positives = 40/84 (47%)
 Frame = -1

Query: 504  IEQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQE 325
            +EQ + Q H   V    +H+  +   QQE+    +    +EQH     + H+  +  +Q+
Sbjct: 847  VEQVVEQHHQEQVENHQEHVEQQVENQQEKEIIHQVEHVIEQHHQEQVENHQEHV--EQQ 904

Query: 324  VPHLLEQQKVQRRVQL*EQQMELH 253
            V +  E++ + +  Q  EQ +E H
Sbjct: 905  VENQQEKEIIHQEQQQVEQVVEQH 928


>UniRef50_Q5XIY8 Cluster: PAX-interacting protein 1; n=3; Danio
           rerio|Rep: PAX-interacting protein 1 - Danio rerio
           (Zebrafish) (Brachydanio rerio)
          Length = 943

 Score = 33.1 bits (72), Expect = 5.7
 Identities = 21/65 (32%), Positives = 36/65 (55%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q +QQ+Q +  +     +Q QH MA+QH M L    ++ H  +QQ+ Q   Q  +QQ +
Sbjct: 402 QQLLQQQQQQSHQ--LQQQQQQHQMAQQHPMMLPQVMQMHHHQQQQQHQPPPQQ-QQQQQ 458

Query: 258 LHRGY 244
             +G+
Sbjct: 459 NQQGF 463



 Score = 33.1 bits (72), Expect = 5.7
 Identities = 18/63 (28%), Positives = 34/63 (53%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ+Q + ++     +Q Q +  + H+  L  QQ   H L+QQ  Q+ +Q  +QQ +
Sbjct: 558 QQQQQQQQQQQQQQQKQQQQQQQNQQQMHQQYLQQQQ---HFLQQQLQQQHMQQLQQQQQ 614

Query: 258 LHR 250
           + +
Sbjct: 615 MQQ 617


>UniRef50_P36417 Cluster: G-box-binding factor; n=3; Dictyostelium
           discoideum|Rep: G-box-binding factor - Dictyostelium
           discoideum (Slime mold)
          Length = 708

 Score = 33.1 bits (72), Expect = 5.7
 Identities = 17/58 (29%), Positives = 30/58 (51%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQ 265
           +QH QQ+Q + ++     + HQHS  +Q       QQ   +  + Q+ Q ++Q+  QQ
Sbjct: 204 QQHHQQQQQQQQQHHQQQQHHQHSQPQQQHQHNQQQQHQHNQQQHQQQQNQIQMVPQQ 261


>UniRef50_UPI0001554BDF Cluster: PREDICTED: similar to tumor protein
           p53 binding protein, 1; n=1; Ornithorhynchus
           anatinus|Rep: PREDICTED: similar to tumor protein p53
           binding protein, 1 - Ornithorhynchus anatinus
          Length = 1012

 Score = 32.7 bits (71), Expect = 7.5
 Identities = 24/76 (31%), Positives = 35/76 (46%), Gaps = 7/76 (9%)
 Frame = -1

Query: 447 MGSRQHMQQEQGECREPLAGLE----QHQHSMAKQHRM---PLLGQQEVPHLLEQQKVQR 289
           +G+ + +QQ QG+C E    L+    QHQ S  +Q R+     L Q E+  L   Q    
Sbjct: 310 LGAEEQVQQMQGKCEELFTELQELQLQHQASQEEQSRLLEELRLCQDELHRLQNAQGPSA 369

Query: 288 RVQL*EQQMELHRGYG 241
             Q   ++  LHR  G
Sbjct: 370 TTQEKSRKCSLHRSTG 385


>UniRef50_UPI0000E48D50 Cluster: PREDICTED: similar to neurogenic
            locus notch (notch); n=3; Strongylocentrotus
            purpuratus|Rep: PREDICTED: similar to neurogenic locus
            notch (notch) - Strongylocentrotus purpuratus
          Length = 2205

 Score = 32.7 bits (71), Expect = 7.5
 Identities = 32/110 (29%), Positives = 44/110 (40%), Gaps = 17/110 (15%)
 Frame = +2

Query: 251  LCNSICCSYSCTLRCTFC---CS---NRCGTSCCPSSGILCCFAI---LCWC-------- 379
            LC     SYSC  +  F    C    N C ++ C + G LC  A+    C+C        
Sbjct: 732  LCVDGIASYSCDCKTGFAGDLCGININECSSNPCRNGG-LCVDAVGGYTCYCTLGFEGEH 790

Query: 380  CSNPASGSLHSPCSCCICCRLPIWSSTSSTFPVWICTSVCSIDEKEHKAF 529
            CSN A   L  PC     C +  ++S S + P       C +D  E  +F
Sbjct: 791  CSNVADNCLSQPCQNSATC-INGFASYSCSCPEGFMGFNCEMDINECLSF 839


>UniRef50_UPI0000E2275A Cluster: PREDICTED: hypothetical protein;
           n=1; Pan troglodytes|Rep: PREDICTED: hypothetical
           protein - Pan troglodytes
          Length = 384

 Score = 32.7 bits (71), Expect = 7.5
 Identities = 13/55 (23%), Positives = 21/55 (38%), Gaps = 1/55 (1%)
 Frame = +2

Query: 269 CSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLH-SPCSCCI 430
           C + C +     C++     CC  +  +C    +C CC   A        C CC+
Sbjct: 237 CVHGCPVGAACVCADPGVCGCCVGAACVCAEPGVCGCCVGAACVCAEPGVCGCCV 291


>UniRef50_UPI0000DB709E Cluster: PREDICTED: similar to corto
           CG2530-PA; n=1; Apis mellifera|Rep: PREDICTED: similar
           to corto CG2530-PA - Apis mellifera
          Length = 625

 Score = 32.7 bits (71), Expect = 7.5
 Identities = 17/58 (29%), Positives = 29/58 (50%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQ 265
           + H QQ+Q     P    +Q  H + + H  PL  QQ+     +QQ+ +++ Q  +QQ
Sbjct: 290 QHHPQQQQQSQAPPPQQQQQSHHHLHRSHAHPLHNQQQQQQQQQQQQHRQQQQQPQQQ 347


>UniRef50_UPI0000D62322 Cluster: Keratin-associated protein 1-5
           (Keratin-associated protein 1.5) (High sulfur
           keratin-associated protein 1.5).; n=5; Eutheria|Rep:
           Keratin-associated protein 1-5 (Keratin-associated
           protein 1.5) (High sulfur keratin-associated protein
           1.5). - Homo sapiens
          Length = 165

 Score = 32.7 bits (71), Expect = 7.5
 Identities = 25/70 (35%), Positives = 30/70 (42%), Gaps = 12/70 (17%)
 Frame = +2

Query: 266 CCSYSCTLRCTFCCSNRCGTSCCPSS--GILCCFAILCWC--CSNPA---SGSLHSPC-- 418
           CC  S     +F  S  CG+SCC  S     CC    C    C  P+   SG+  S C  
Sbjct: 3   CCQTSFCGYPSFSISGTCGSSCCQPSCCETSCCQPRSCQTSFCGFPSFSTSGTCSSSCCQ 62

Query: 419 -SCC--ICCR 439
            SCC   CC+
Sbjct: 63  PSCCETSCCQ 72


>UniRef50_Q8QNJ9 Cluster: EsV-1-74; n=1; Ectocarpus siliculosus
           virus 1|Rep: EsV-1-74 - Ectocarpus siliculosus virus 1
          Length = 509

 Score = 32.7 bits (71), Expect = 7.5
 Identities = 18/68 (26%), Positives = 35/68 (51%)
 Frame = -1

Query: 465 LEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRR 286
           ++ + HM  +Q MQQ Q + R+    ++  Q    +  +     QQ+   L +QQ+ Q++
Sbjct: 15  MQHIQHMQHQQQMQQRQAQQRQMQMQMQMEQQQQQRILQQQQQQQQQQRILQQQQQQQQQ 74

Query: 285 VQL*EQQM 262
            Q  +QQ+
Sbjct: 75  QQQQQQQI 82


>UniRef50_A3QTQ8 Cluster: ORF99; n=3; Koi herpesvirus|Rep: ORF99 - Koi
            herpesvirus
          Length = 1541

 Score = 32.7 bits (71), Expect = 7.5
 Identities = 22/64 (34%), Positives = 25/64 (39%), Gaps = 3/64 (4%)
 Frame = +2

Query: 254  CNSICCSYSCTLRCTFC--CSNRCGT-SCCPSSGILCCFAILCWCCSNPASGSLHSPCSC 424
            C  +C    C   C  C  C   CG  SCC       C   +  CC+ P   SL S CS 
Sbjct: 1451 CGGLCGL--CGGGCGGCGLCGGCCGACSCCGPCIATACAPCIA-CCALPCCVSLCSCCSS 1507

Query: 425  CICC 436
            C  C
Sbjct: 1508 CSRC 1511


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 482,724,551
Number of Sequences: 1657284
Number of extensions: 9460989
Number of successful extensions: 54751
Number of sequences better than 10.0: 336
Number of HSP's better than 10.0 without gapping: 35218
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 46078
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 46881492319
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).