SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0008
         (564 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q11WP9 Cluster: Acyltransferase family protein; n=1; Cy...    34   2.0  
UniRef50_Q0U0T9 Cluster: Predicted protein; n=2; cellular organi...    34   2.0  
UniRef50_Q91G04 Cluster: 135R; n=1; Invertebrate iridescent viru...    33   4.6  
UniRef50_Q87ZE4 Cluster: Lipase family protein; n=3; Pseudomonas...    33   6.1  

>UniRef50_Q11WP9 Cluster: Acyltransferase family protein; n=1;
           Cytophaga hutchinsonii ATCC 33406|Rep: Acyltransferase
           family protein - Cytophaga hutchinsonii (strain ATCC
           33406 / NCIMB 9469)
          Length = 358

 Score = 34.3 bits (75), Expect = 2.0
 Identities = 28/81 (34%), Positives = 41/81 (50%), Gaps = 3/81 (3%)
 Frame = -3

Query: 277 YIIFCYILLCTGTSGLTIFGRLIVGNRHLKTSLESISDI*SVPLVFYFKSLS*LLLQFHK 98
           YI+   I LC G   + +F   ++G    K S  ++S I SV L   F + S L++    
Sbjct: 166 YILLALIFLCIGYKIVLLFPIWLMGVALFKLSKHTVSTIFSVLL---FVATSILIIGLVT 222

Query: 97  KNMHILFCVVFYI---YFFCS 44
           +N+H +F VV  I   YFF S
Sbjct: 223 ENIHPVFPVVSRIGDPYFFYS 243


>UniRef50_Q0U0T9 Cluster: Predicted protein; n=2; cellular
           organisms|Rep: Predicted protein - Phaeosphaeria nodorum
           (Septoria nodorum)
          Length = 55

 Score = 34.3 bits (75), Expect = 2.0
 Identities = 15/37 (40%), Positives = 19/37 (51%)
 Frame = +1

Query: 241 FRYIIKYNKI*YTHFTLYMNYNNSYGYINCYNPHDEL 351
           + Y   YN   Y ++  Y NY N Y Y N YN H+ L
Sbjct: 15  YNYCNYYNYYNYYNYYNYCNYYNYYNYCNYYNYHNNL 51


>UniRef50_Q91G04 Cluster: 135R; n=1; Invertebrate iridescent virus
           6|Rep: 135R - Chilo iridescent virus (CIV) (Insect
           iridescent virus type 6)
          Length = 71

 Score = 33.1 bits (72), Expect = 4.6
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 1/58 (1%)
 Frame = -1

Query: 195 ISRLRLSRFPTFNPFHLYFILKVFHSYCCNFIK-KTCIFYFVSCFIYIFSVV*FTSVC 25
           +++   SRF  F+ F  +  +  F +    FI  K  IF FV+ F YIF+   FTS+C
Sbjct: 1   MTKFTFSRFVIFSLFFTFISVSTFGNINFRFIVCKWTIFSFVALF-YIFTHTSFTSLC 57


>UniRef50_Q87ZE4 Cluster: Lipase family protein; n=3;
           Pseudomonas|Rep: Lipase family protein - Pseudomonas
           syringae pv. tomato
          Length = 758

 Score = 32.7 bits (71), Expect = 6.1
 Identities = 27/114 (23%), Positives = 47/114 (41%)
 Frame = +1

Query: 151 ERIKCRKSTQAKS*DVDFPLSIDRKSLGPTFRYIIKYNKI*YTHFTLYMNYNNSYGYINC 330
           E +   K  +    D D    ++R SLG    +  K +   +   T   N  ++  +I  
Sbjct: 305 EEVAYSKRLEIVPFDPDLYPEVNRPSLGDDQEHPAKIH---FFDDTTSKNGTDTQAFIT- 360

Query: 331 YNPHDEL*IMLQRP*SQTRTVFEQMKRANIAIRDSNGKVHTGTFYTGQRPIYHF 492
              HDE+ ++  R  + T   F  +  A +   +  GKVH G FY   + + +F
Sbjct: 361 --HHDEIVLLSVRGTASTSDAFRDLDAAQVPFEEGVGKVHNG-FYGSAKAVINF 411


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 532,394,056
Number of Sequences: 1657284
Number of extensions: 10479355
Number of successful extensions: 24028
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 22866
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 23972
length of database: 575,637,011
effective HSP length: 96
effective length of database: 416,537,747
effective search space used: 37904934977
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).