SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0045
         (841 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292339-1|CAL23151.2|  387|Tribolium castaneum gustatory recept...    21   9.2  
AM292338-1|CAL23150.2|  372|Tribolium castaneum gustatory recept...    21   9.2  
AJ518940-1|CAD57734.1|  361|Tribolium castaneum extradenticle pr...    21   9.2  

>AM292339-1|CAL23151.2|  387|Tribolium castaneum gustatory receptor
           candidate 18 protein.
          Length = 387

 Score = 21.4 bits (43), Expect = 9.2
 Identities = 6/12 (50%), Positives = 9/12 (75%)
 Frame = +1

Query: 73  TVCMVVASIYIW 108
           T C+ + S+YIW
Sbjct: 41  TTCIYLTSLYIW 52


>AM292338-1|CAL23150.2|  372|Tribolium castaneum gustatory receptor
           candidate 17 protein.
          Length = 372

 Score = 21.4 bits (43), Expect = 9.2
 Identities = 6/12 (50%), Positives = 9/12 (75%)
 Frame = +1

Query: 73  TVCMVVASIYIW 108
           T C+ + S+YIW
Sbjct: 41  TTCIYLTSLYIW 52


>AJ518940-1|CAD57734.1|  361|Tribolium castaneum extradenticle
           protein.
          Length = 361

 Score = 21.4 bits (43), Expect = 9.2
 Identities = 11/38 (28%), Positives = 20/38 (52%), Gaps = 2/38 (5%)
 Frame = -2

Query: 723 TKDATLDLNDKINATVSKVIDWMNKNNL--KANLDKTR 616
           +++A  +L  K   TVS+V +W     +  K N+ K +
Sbjct: 259 SEEAKEELARKCGITVSQVSNWFGNKRIRYKKNIGKAQ 296


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 196,395
Number of Sequences: 336
Number of extensions: 4806
Number of successful extensions: 6
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 23140487
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -