BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40005 (718 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP19A11.03c |mts4|rpn1|19S proteasome regulatory subunit Mts4|... 31 0.12 SPBC418.02 |||NatA N-acetyltransferase complex subunit |Schizosa... 29 0.88 SPAC869.04 |||formamidase-like protein|Schizosaccharomyces pombe... 28 1.5 SPAC14C4.04 |B22918-2||hypothetical protein|Schizosaccharomyces ... 27 2.0 SPAC513.06c |||dihydrodiol dehydrogenase |Schizosaccharomyces po... 26 4.7 SPBC36B7.08c |||nucleosome assembly protein |Schizosaccharomyces... 26 6.2 SPCC18.06c |caf1|pop2|CCR4-Not complex subunit Caf1|Schizosaccha... 26 6.2 SPCC338.04 |cid2||caffeine induced death protein Cid2|Schizosacc... 25 8.2 >SPBP19A11.03c |mts4|rpn1|19S proteasome regulatory subunit Mts4|Schizosaccharomyces pombe|chr 2|||Manual Length = 891 Score = 31.5 bits (68), Expect = 0.12 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -2 Query: 489 SVSVIQTEGRVDCSALIHELDRASRVC*YVTDC 391 ++ ++Q G ++ ELD ASRVC Y+T C Sbjct: 206 AIDLLQELGAIEKVVPFVELDNASRVCLYITSC 238 >SPBC418.02 |||NatA N-acetyltransferase complex subunit |Schizosaccharomyces pombe|chr 2|||Manual Length = 695 Score = 28.7 bits (61), Expect = 0.88 Identities = 14/54 (25%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Frame = +1 Query: 532 VPSITCQLQLPRESTDFFGDLLYPYAEDIMKSDATKPLEEHK-FLLRCLWVYHH 690 +PS L++P ++ D F L + + D+ K + HK + CL + H+ Sbjct: 323 IPSFISLLKIPLKTNDAFSKKLITMLSNFREGDSAKNIPTHKLWCTYCLCLAHY 376 >SPAC869.04 |||formamidase-like protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 410 Score = 27.9 bits (59), Expect = 1.5 Identities = 12/49 (24%), Positives = 23/49 (46%) Frame = +1 Query: 385 MLAICDISADPGGSIEFMNECTTIDTPFCLYDADRNKDTKSSKVQEYLC 531 +L+ I G ++ N CTTI P +++ D + + K+ + C Sbjct: 357 LLSCAPIQGHVAGIVDIPNSCTTIGVPMDIFEFDVSPNGKAKIIDLGSC 405 >SPAC14C4.04 |B22918-2||hypothetical protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 267 Score = 27.5 bits (58), Expect = 2.0 Identities = 11/35 (31%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +1 Query: 319 LIMPAHTP-WLPKSIGAPALPHRMLAICDISADPG 420 ++ P P W+P +G HR L +C + D G Sbjct: 15 MLQPFSNPLWVPTPVGRSGRKHRTLKMCIVLPDTG 49 >SPAC513.06c |||dihydrodiol dehydrogenase |Schizosaccharomyces pombe|chr 1|||Manual Length = 368 Score = 26.2 bits (55), Expect = 4.7 Identities = 14/38 (36%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -1 Query: 601 DRVG-PRRNRSTHEAVEVGMLSMEHTSTPGPLNSSYPC 491 D VG P R++ HE V V EH ++ N PC Sbjct: 28 DLVGVPERHKVQHEIVAVATRDSEHRASSFAKNHCAPC 65 >SPBC36B7.08c |||nucleosome assembly protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 244 Score = 25.8 bits (54), Expect = 6.2 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 Query: 192 KVERGKEDDGSDTKIAPYTS 251 K E+ K+D+G + KI YTS Sbjct: 118 KEEKAKDDEGLEKKITKYTS 137 >SPCC18.06c |caf1|pop2|CCR4-Not complex subunit Caf1|Schizosaccharomyces pombe|chr 3|||Manual Length = 332 Score = 25.8 bits (54), Expect = 6.2 Identities = 18/59 (30%), Positives = 26/59 (44%) Frame = +3 Query: 216 DGSDTKIAPYTSVWSTASIGQLTVRNYSRYLMRTPHHAGTYPVVTEEHRSPGVTAQNAG 392 DG ++I+P VWST N + + YPVV+ + PGV A+ G Sbjct: 13 DGISSQISPIRDVWST---------NLQQEMNLIMSLIERYPVVSMDTEFPGVVARPLG 62 >SPCC338.04 |cid2||caffeine induced death protein Cid2|Schizosaccharomyces pombe|chr 3|||Manual Length = 167 Score = 25.4 bits (53), Expect = 8.2 Identities = 24/80 (30%), Positives = 34/80 (42%) Frame = +1 Query: 430 EFMNECTTIDTPFCLYDADRNKDTKSSKVQEYLCVPSITCQLQLPRESTDFFGDLLYPYA 609 +F+ EC TI D DRN K Q+ QLP ST + L PYA Sbjct: 69 QFLKECQTIVRS--QLDQDRNTSKSPLKSQQ-----------QLPSSSTTQVSERLDPYA 115 Query: 610 EDIMKSDATKPLEEHKFLLR 669 +++ P EE + +L+ Sbjct: 116 KEVQVQ--LSPPEEVQIVLQ 133 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,894,911 Number of Sequences: 5004 Number of extensions: 60417 Number of successful extensions: 159 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 150 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 158 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 335201398 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -