SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30010
         (545 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC4H3.04c |||UPF0103 family|Schizosaccharomyces pombe|chr 1|||...    29   0.34 
SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family ...    25   5.5  

>SPAC4H3.04c |||UPF0103 family|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 309

 Score = 29.5 bits (63), Expect = 0.34
 Identities = 13/52 (25%), Positives = 27/52 (51%)
 Frame = -1

Query: 449 LYDELASYRRRTDPKRPDLHYSISNFNYSAIELLKVALRSFLRQIGRTAGNS 294
           L D +  Y+RR  P  P ++ SISN ++  +++++        +  +T  N+
Sbjct: 209 LEDAVLKYKRRGGPTSPKIYESISNLDHIGMKIIETKSSDDFSEYLKTTQNT 260


>SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1420

 Score = 25.4 bits (53), Expect = 5.5
 Identities = 10/16 (62%), Positives = 12/16 (75%)
 Frame = -3

Query: 435 GQLPAPDRPETTRPSL 388
           G  P P RPE+TRP+L
Sbjct: 758 GPPPQPARPESTRPAL 773


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,198,068
Number of Sequences: 5004
Number of extensions: 43630
Number of successful extensions: 82
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 78
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 82
length of database: 2,362,478
effective HSP length: 69
effective length of database: 2,017,202
effective search space used: 225926624
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).