SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0033
         (698 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC26H8.07c |nda3|ben1, alp12|tubulin beta |Schizosaccharomyces...   145   5e-36
SPBC800.05c |tub1|atb2, alp2, ban5|tubulin alpha 2|Schizosacchar...    87   2e-18
SPBC16A3.15c |nda2||tubulin alpha 1|Schizosaccharomyces pombe|ch...    86   4e-18
SPBC32F12.04 |tug1|gtb1|gamma-tubulin|Schizosaccharomyces pombe|...    58   1e-09
SPAC29A4.06c |||human CCDC55 homolog|Schizosaccharomyces pombe|c...    28   1.1  
SPBC27.02c |ask1|mug181|DASH complex subunit Ask1|Schizosaccharo...    28   1.1  
SPAC3H8.04 |||chromosome segregation protein|Schizosaccharomyces...    27   2.6  
SPCC576.02 |||hydantoin racemase family |Schizosaccharomyces pom...    26   4.5  

>SPBC26H8.07c |nda3|ben1, alp12|tubulin beta |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 448

 Score =  145 bits (352), Expect = 5e-36
 Identities = 66/105 (62%), Positives = 83/105 (79%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           +G+TT  RFPG+LN+DLRKLAVNMVPFPRLHF+  GFAPL + G+  ++A++VPELT QM
Sbjct: 234 AGVTTSFRFPGELNSDLRKLAVNMVPFPRLHFFMVGFAPLAAIGSSSFQAVSVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTKTA 316
           FDA NMMVA DPRHGRYLTVA +FRG+   K++    R  +TK +
Sbjct: 294 FDANNMMVAADPRHGRYLTVAALFRGKVSMKEVDEQIRSVQTKNS 338



 Score =  138 bits (333), Expect = 9e-34
 Identities = 58/85 (68%), Positives = 74/85 (87%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +G++SMKEVDEQ+ ++Q KNS YFVEWIP+N   AVC +PP+ LKM++TFIGN+T+IQ I
Sbjct: 318 RGKVSMKEVDEQIRSVQTKNSAYFVEWIPDNVLKAVCSVPPKDLKMSATFIGNSTSIQEI 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           F+R+ +QF AMFRRKAFLHWYTGEG
Sbjct: 378 FRRLGDQFSAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 1e-08
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>SPBC800.05c |tub1|atb2, alp2, ban5|tubulin alpha
           2|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 449

 Score = 87.0 bits (206), Expect = 2e-18
 Identities = 38/89 (42%), Positives = 54/89 (60%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     + + +V E+T Q 
Sbjct: 236 SSITASLRFEGSLNVDLAEFQTNLVPYPRIHFPLVTYAPIVSAAKAFHESNSVQEITNQC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL 268
           F+  N MV CDPR GRY+    ++RG+ +
Sbjct: 296 FEPYNQMVKCDPRAGRYMATCLLYRGDVI 324



 Score = 65.7 bits (153), Expect = 6e-12
 Identities = 30/93 (32%), Positives = 51/93 (54%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLK--------MASTFIG 408
           +G +  ++V   +  I+ K +  FV+W P   KI +CD PP+ ++         A   + 
Sbjct: 320 RGDVIPRDVQAAVTTIKAKRTIQFVDWCPTGFKIGICDRPPQHIEGSEIAKVDRAVCMLS 379

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTT+I   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 380 NTTSIAEAWSRLDHKFDLMYSKRAFVHWYVGEG 412


>SPBC16A3.15c |nda2||tubulin alpha 1|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 455

 Score = 86.2 bits (204), Expect = 4e-18
 Identities = 37/89 (41%), Positives = 54/89 (60%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    ++P+ S     + + +V E+T Q 
Sbjct: 240 SSITASLRFAGSLNVDLNEFQTNLVPYPRIHFPLVTYSPIVSAAKAFHESNSVQEITNQC 299

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL 268
           F+  N MV CDPR GRY+    ++RG+ +
Sbjct: 300 FEPYNQMVKCDPRTGRYMATCLLYRGDVI 328



 Score = 61.7 bits (143), Expect = 1e-10
 Identities = 28/93 (30%), Positives = 51/93 (54%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGL--------KMASTFIG 408
           +G +  ++V   + +I+++ +  FV+W P   KI +C  PP+ +          A   + 
Sbjct: 324 RGDVIPRDVQAAVTSIKSRRTIQFVDWCPTGFKIGICYEPPQHVPGSGIAKVNRAVCMLS 383

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTT+I   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 384 NTTSIAEAWSRLDHKFDLMYSKRAFVHWYVGEG 416


>SPBC32F12.04 |tug1|gtb1|gamma-tubulin|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 446

 Score = 58.0 bits (134), Expect = 1e-09
 Identities = 28/91 (30%), Positives = 53/91 (58%), Gaps = 4/91 (4%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRAL---TVPELT 172
           S  TT LR+PG +N DL  +  +++P PR HF    + P T++  ++ +A+   TV ++ 
Sbjct: 237 SASTTTLRYPGYMNNDLVSIIASLIPSPRCHFLLTSYTPFTNQQVEEAKAIRKTTVLDVM 296

Query: 173 LQMFDAKNMMVACDP-RHGRYLTVATIFRGE 262
            ++   KN MV+ +P +   ++++  I +GE
Sbjct: 297 RRLLLPKNQMVSVNPSKKSCFISILDIIQGE 327



 Score = 46.4 bits (105), Expect = 4e-06
 Identities = 25/90 (27%), Positives = 45/90 (50%), Gaps = 3/90 (3%)
 Frame = +1

Query: 244 DDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPP---RGLKMASTFIGNT 414
           D IQG     +V + L  I+ +    F+ W P + ++A+    P      +++   + N 
Sbjct: 322 DIIQGEADPADVHKSLLRIRERRYASFIPWGPASIQVALSKKSPYIKTNHRVSGLMLANH 381

Query: 415 TAIQTIFKRVSEQFVAMFRRKAFLHWYTGE 504
           T+I ++FKR  +Q+  + +R AFL  Y  E
Sbjct: 382 TSIASLFKRTLDQYDRLRKRNAFLEQYKKE 411


>SPAC29A4.06c |||human CCDC55 homolog|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 355

 Score = 28.3 bits (60), Expect = 1.1
 Identities = 16/55 (29%), Positives = 26/55 (47%)
 Frame = +1

Query: 145 SSFNCTRADAANVRRQKHDGRV*SSTREVFDRCDDIQGRMSMKEVDEQLANIQNK 309
           S+ N  R D     +  +   +  STR   DR D   G  S++E+D+Q    +N+
Sbjct: 253 SANNSMRDDKKRNHKSSYKRSLSPSTRYHQDRPDKRHGTYSLEEIDKQRKEFENR 307


>SPBC27.02c |ask1|mug181|DASH complex subunit
           Ask1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 307

 Score = 28.3 bits (60), Expect = 1.1
 Identities = 15/48 (31%), Positives = 23/48 (47%)
 Frame = -1

Query: 296 FASCSSTSFIDIRP*ISSQRSNTSRVEDHTRPSCFWRRTFAASARVQL 153
           F+ C  T    I P +     N + + D ++   FW++ F ASA V L
Sbjct: 25  FSKCHRTVTTKILPIVEKYAKNCNTIWDSSK---FWKQFFEASANVSL 69


>SPAC3H8.04 |||chromosome segregation protein|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 338

 Score = 27.1 bits (57), Expect = 2.6
 Identities = 16/60 (26%), Positives = 30/60 (50%), Gaps = 2/60 (3%)
 Frame = +2

Query: 290 WRIFRTKTARILSSGYPITARLPCVTYLRGVLKWLRPSL--VTRRPYRPYSRGCLSSSWL 463
           +R+   K+ ++++ GYP   R+P V  L+ +L+     +  V   PY   S    S +W+
Sbjct: 208 FRLRSQKSDKVMNKGYPFGYRIPSVGQLQLILRQTNGLVIKVFLVPYNVSSMVDCSKTWI 267


>SPCC576.02 |||hydantoin racemase family |Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 236

 Score = 26.2 bits (55), Expect = 4.5
 Identities = 11/32 (34%), Positives = 20/32 (62%)
 Frame = +2

Query: 239 VATIFRGECL*KKLTSNWRIFRTKTARILSSG 334
           + + +R ECL  +L  ++ + RT+ A I S+G
Sbjct: 117 LTSTYRSECLLYELLDSFGVSRTRVAAIASTG 148


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,690,447
Number of Sequences: 5004
Number of extensions: 53598
Number of successful extensions: 169
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 161
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 166
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 323158234
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).