SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0010
         (598 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC215.03c |csn1||COP9/signalosome complex subunit Csn1|Schizos...    29   0.39 
SPAC14C4.02c |smc5|spr18|Smc5-6 complex SMC subunit Smc5 |Schizo...    28   0.90 
SPACUNK4.12c |mug138||metallopeptidase|Schizosaccharomyces pombe...    27   1.6  
SPBC21D10.09c |||ubiquitin-protein ligase E3 |Schizosaccharomyce...    25   6.3  
SPAC869.03c |||urea transporter |Schizosaccharomyces pombe|chr 1...    25   6.3  

>SPBC215.03c |csn1||COP9/signalosome complex subunit
           Csn1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 422

 Score = 29.5 bits (63), Expect = 0.39
 Identities = 23/70 (32%), Positives = 37/70 (52%), Gaps = 9/70 (12%)
 Frame = +3

Query: 339 NSVQIIDAKK--GK--NVLKRVQLPPLNL-----DMLQIGNIVNIFSKLLYIQDCGSCYT 491
           N ++II+AKK  GK  ++ KRV + P +      D+  I     ++SK LY+Q   +  T
Sbjct: 341 NLLEIIEAKKLNGKVDSLQKRVYIEPSSEPENFEDIKNIAQTSLLYSKALYLQTLAAMNT 400

Query: 492 ENAFQKCQVL 521
           EN   +  V+
Sbjct: 401 ENTDDEAPVI 410


>SPAC14C4.02c |smc5|spr18|Smc5-6 complex SMC subunit Smc5
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1065

 Score = 28.3 bits (60), Expect = 0.90
 Identities = 12/44 (27%), Positives = 23/44 (52%)
 Frame = +3

Query: 219 QVDIDSNGIRLLDKYSFXCEMYDEDADEIKDLTLNYFPFDNSVQ 350
           ++ I+   ++ ++  S+  E YD    EI++L      FD SV+
Sbjct: 838 KISIEETKLKFMNVNSYVMEQYDARKKEIEELESKMSDFDQSVE 881


>SPACUNK4.12c |mug138||metallopeptidase|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 969

 Score = 27.5 bits (58), Expect = 1.6
 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 2/43 (4%)
 Frame = -1

Query: 556 RSTGSYRLKSWQS-TWHFWKAFSV*QEPQSWIYN-NXENILTI 434
           R+  S   K+ QS +W FW+ +SV   P+S     N  NI T+
Sbjct: 144 RAVDSEHCKNLQSDSWRFWRLYSVLSNPKSVFSKFNTGNIETL 186


>SPBC21D10.09c |||ubiquitin-protein ligase E3 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 1610

 Score = 25.4 bits (53), Expect = 6.3
 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 1/46 (2%)
 Frame = +3

Query: 330 PFDNSVQIIDAKKGKNVLKRVQLPPLNLDMLQIG-NIVNIFSKLLY 464
           PF ++   ID       L  V   P+N+DM  +G   V+IF   LY
Sbjct: 838 PFFSNKLFIDQDFILGFLDLVASEPINVDMTDVGTQFVHIFHASLY 883


>SPAC869.03c |||urea transporter |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 661

 Score = 25.4 bits (53), Expect = 6.3
 Identities = 15/55 (27%), Positives = 23/55 (41%)
 Frame = +1

Query: 430 VI*LIYFXNYYISRIAAPATRKTLSKSAKYFAMIXADSSQWTWENNPLSSWKMDF 594
           +I + Y    Y+  +       T S+S K   +  A  S WTW    L+S  M +
Sbjct: 26  MILVTYVLKRYVGEVQDSEHFTTASRSVKTGLISSAVVSSWTWPGTLLTSAGMAY 80


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,355,449
Number of Sequences: 5004
Number of extensions: 44466
Number of successful extensions: 127
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 121
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 127
length of database: 2,362,478
effective HSP length: 69
effective length of database: 2,017,202
effective search space used: 260219058
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).