SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0008
         (698 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC212.11 |tlh1||RecQ type DNA helicase|Schizosaccharomyces pom...    29   0.85 
SPAC3G9.11c |||pyruvate decarboxylase |Schizosaccharomyces pombe...    29   0.85 
SPBCPT2R1.08c |tlh2||RecQ type DNA helicase Tlh1|Schizosaccharom...    29   0.85 
SPAC9G1.13c |||histone acetyltransferase complex subunit Swc4 |S...    29   0.85 
SPBC1105.15c |htd2||3-hydroxyacyl-ACP dehydratase Htd2 |Schizosa...    27   2.0  
SPBP8B7.18c |||phosphomethylpyrimidine kinase|Schizosaccharomyce...    27   2.0  
SPCC74.09 |mug24||RNA-binding protein, rrm type|Schizosaccharomy...    27   2.0  
SPAC13A11.06 ||SPAC3H8.01|pyruvate decarboxylase |Schizosaccharo...    27   2.0  
SPAC17G6.11c |||glucosidase |Schizosaccharomyces pombe|chr 1|||M...    27   2.6  
SPBC30B4.01c |wsc1|SPBC3D6.14c|transmembrane receptor Wsc1 |Schi...    26   4.5  
SPAC56E4.04c |cut6||acetyl-CoA carboxylase|Schizosaccharomyces p...    25   7.9  

>SPAC212.11 |tlh1||RecQ type DNA helicase|Schizosaccharomyces
            pombe|chr 1||Partial|Manual
          Length = 1887

 Score = 28.7 bits (61), Expect = 0.85
 Identities = 25/65 (38%), Positives = 35/65 (53%), Gaps = 2/65 (3%)
 Frame = +1

Query: 226  RDGKYFIAAVDVENQKYRKTHWNATNTSKMR--MSNSPRAVRDCVASSK*MERE*CKPEG 399
            RDGKY IAA+  E  KY  T W++     M+  ++++   VR  +AS   M+ E C    
Sbjct: 1514 RDGKYAIAALFYE--KYDST-WSSYVEDSMKNFLNDNTMCVRSFLASE--MDGE-CVCCA 1567

Query: 400  SLANC 414
            S ANC
Sbjct: 1568 SFANC 1572


>SPAC3G9.11c |||pyruvate decarboxylase |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 570

 Score = 28.7 bits (61), Expect = 0.85
 Identities = 10/20 (50%), Positives = 14/20 (70%)
 Frame = -3

Query: 663 FVLSNSGYTVERFXRGLSCI 604
           FV++N GYT+ER   GL  +
Sbjct: 474 FVINNKGYTIERLIHGLHAV 493


>SPBCPT2R1.08c |tlh2||RecQ type DNA helicase Tlh1|Schizosaccharomyces
            pombe|chr 2|||Manual
          Length = 1919

 Score = 28.7 bits (61), Expect = 0.85
 Identities = 25/65 (38%), Positives = 35/65 (53%), Gaps = 2/65 (3%)
 Frame = +1

Query: 226  RDGKYFIAAVDVENQKYRKTHWNATNTSKMR--MSNSPRAVRDCVASSK*MERE*CKPEG 399
            RDGKY IAA+  E  KY  T W++     M+  ++++   VR  +AS   M+ E C    
Sbjct: 1514 RDGKYAIAALFYE--KYDST-WSSYVEDSMKNFLNDNTMCVRSFLASE--MDGE-CVCCA 1567

Query: 400  SLANC 414
            S ANC
Sbjct: 1568 SFANC 1572


>SPAC9G1.13c |||histone acetyltransferase complex subunit Swc4
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 411

 Score = 28.7 bits (61), Expect = 0.85
 Identities = 11/39 (28%), Positives = 25/39 (64%), Gaps = 1/39 (2%)
 Frame = +1

Query: 169 QPWQEWSDHYTCHRYR-CEIRDGKYFIAAVDVENQKYRK 282
           + +++W+   T + +R C+  D ++F+ A   +N+KY+K
Sbjct: 97  EAYEDWNKDETDYLFRLCKDYDLRFFVIADRYDNEKYKK 135


>SPBC1105.15c |htd2||3-hydroxyacyl-ACP dehydratase Htd2
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 300

 Score = 27.5 bits (58), Expect = 2.0
 Identities = 13/37 (35%), Positives = 20/37 (54%)
 Frame = +3

Query: 225 QRREILHSCCGCRKPKIPENALECHEYIEDENVEFPT 335
           +RR  LH      +P       ECHE I++E+V+ P+
Sbjct: 79  KRRIWLHGVLRFHRPLHLFQTSECHELIQEESVKSPS 115


>SPBP8B7.18c |||phosphomethylpyrimidine kinase|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 551

 Score = 27.5 bits (58), Expect = 2.0
 Identities = 9/21 (42%), Positives = 13/21 (61%)
 Frame = +1

Query: 172 PWQEWSDHYTCHRYRCEIRDG 234
           P+Q+W D+Y C  Y   +R G
Sbjct: 478 PYQKWVDNYFCEDYLSAVRRG 498


>SPCC74.09 |mug24||RNA-binding protein, rrm type|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 654

 Score = 27.5 bits (58), Expect = 2.0
 Identities = 13/30 (43%), Positives = 16/30 (53%)
 Frame = -1

Query: 542 CC*IFQETPDPGLATDRCLLDAAHSDNSRI 453
           CC  FQET   G A   C L+ +  DNS +
Sbjct: 35  CC--FQETGSTGTANSICTLNDSEDDNSSL 62


>SPAC13A11.06 ||SPAC3H8.01|pyruvate decarboxylase
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 571

 Score = 27.5 bits (58), Expect = 2.0
 Identities = 9/17 (52%), Positives = 13/17 (76%)
 Frame = -3

Query: 663 FVLSNSGYTVERFXRGL 613
           F+++N GYT+ER   GL
Sbjct: 473 FIINNDGYTIERLIHGL 489


>SPAC17G6.11c |||glucosidase |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 636

 Score = 27.1 bits (57), Expect = 2.6
 Identities = 15/41 (36%), Positives = 19/41 (46%), Gaps = 1/41 (2%)
 Frame = +2

Query: 443 KRAKSCCCRNERHP-ADTGRWRAQGQASPGIFNSRGAADGS 562
           +R   C C+ E HP   TGR   +  A  G F S    +GS
Sbjct: 391 QRLNQCVCKGEDHPNVGTGRGGPEIDALEGTFGSGIPYNGS 431


>SPBC30B4.01c |wsc1|SPBC3D6.14c|transmembrane receptor Wsc1
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 374

 Score = 26.2 bits (55), Expect = 4.5
 Identities = 16/48 (33%), Positives = 25/48 (52%)
 Frame = -2

Query: 421 SGNSSPGCPLVCTILSPFTSTTQRNRAQHVGNSTFSSSMYSWHSSAFS 278
           S +SSP      T  SP +S++  + +    +S+ SSS  S  SS+ S
Sbjct: 139 SSSSSPSSSSTTTTTSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 186


>SPAC56E4.04c |cut6||acetyl-CoA carboxylase|Schizosaccharomyces
            pombe|chr 1|||Manual
          Length = 2280

 Score = 25.4 bits (53), Expect = 7.9
 Identities = 10/22 (45%), Positives = 13/22 (59%)
 Frame = +3

Query: 255  GCRKPKIPENALECHEYIEDEN 320
            G  K  IP+N  EC E + DE+
Sbjct: 1567 GRSKVTIPQNMFECKELVADEH 1588


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,067,576
Number of Sequences: 5004
Number of extensions: 66337
Number of successful extensions: 215
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 211
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 215
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 323158234
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).