SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0099
         (684 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC28E12.03 |rga4||GTPase activating protein Rga4|Schizosacchar...    28   1.4  
SPAC17G8.14c |pck1|SPAC22H10.01c|protein kinase C |Schizosacchar...    28   1.4  
SPAC19G12.16c |adg2|SPAC23A1.01c, mug46|conserved fungal protein...    27   1.9  
SPCP1E11.04c |pal1||membrane associated protein Pal1 |Schizosacc...    27   2.5  
SPBC354.08c |||DUF221 family protein|Schizosaccharomyces pombe|c...    27   3.3  
SPBC215.07c |||PWWP domain protein|Schizosaccharomyces pombe|chr...    26   4.4  
SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr...    25   7.7  
SPCC663.11 |||ww domain binding protein 11 |Schizosaccharomyces ...    25   7.7  

>SPBC28E12.03 |rga4||GTPase activating protein
           Rga4|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 933

 Score = 27.9 bits (59), Expect = 1.4
 Identities = 15/50 (30%), Positives = 26/50 (52%)
 Frame = +1

Query: 478 LSTNNAGVLRQLSEDRNLAWSKRAKAGLIQMFSTHRDCESTAYRSFSIKS 627
           LS+   G+ ++L+   N   S RAK+  +   S H+ CE    RS  +++
Sbjct: 416 LSSEPNGLKKRLTNSSNYEASPRAKSLNLSQVSLHQACEPEYNRSSLVRA 465


>SPAC17G8.14c |pck1|SPAC22H10.01c|protein kinase C
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 988

 Score = 27.9 bits (59), Expect = 1.4
 Identities = 19/70 (27%), Positives = 33/70 (47%)
 Frame = -1

Query: 342 IIDRAPLPPNRVSNETMKVVVFQRRSRETTPTYATPLMSPYNARLESSSTGSSFPADSPK 163
           +++ +PLP     + ++ V         +TPT A+ L  P +A L SS   +    +SP+
Sbjct: 598 VLNTSPLPKTPEKDRSLNVT-----PSSSTPTPASVLAPPSSASLSSSKDANRSVPESPR 652

Query: 162 PVPLAVVSLD 133
                 V+LD
Sbjct: 653 REKKNRVTLD 662


>SPAC19G12.16c |adg2|SPAC23A1.01c, mug46|conserved fungal
           protein|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 670

 Score = 27.5 bits (58), Expect = 1.9
 Identities = 22/78 (28%), Positives = 35/78 (44%), Gaps = 5/78 (6%)
 Frame = -1

Query: 348 ADIIDRAPLPPNRVSNETMKVVVFQRRSRETTPTYATPLMSPYNARLESSSTGSSFPADS 169
           A +   + LP + +++ +  V V        TP+Y+T L +  +     S+T SS P  S
Sbjct: 237 ASLSSSSVLPTSIITSTSTPVTVSSSSLSSFTPSYSTNLTTTGSTTTTGSATVSSSPFYS 296

Query: 168 -----PKPVPLAVVSLDS 130
                P  VP +V S  S
Sbjct: 297 NSSVIPTSVPSSVSSFTS 314


>SPCP1E11.04c |pal1||membrane associated protein Pal1
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 425

 Score = 27.1 bits (57), Expect = 2.5
 Identities = 18/66 (27%), Positives = 30/66 (45%), Gaps = 3/66 (4%)
 Frame = -1

Query: 348 ADIIDRAPLPPNRVSNETMKVVVFQRRSRETTPTYATPLMSPYNARLESSSTG---SSFP 178
           A ++ R P   NR SN      +  RRS   +P+   P+ +   +  + S+TG    + P
Sbjct: 312 ASMMSRTPNTLNRPSNYRSHSSMGTRRSPLNSPSQLDPISNENESDTDDSNTGLRNRTSP 371

Query: 177 ADSPKP 160
             +P P
Sbjct: 372 TAAPPP 377


>SPBC354.08c |||DUF221 family protein|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 865

 Score = 26.6 bits (56), Expect = 3.3
 Identities = 14/42 (33%), Positives = 19/42 (45%)
 Frame = -2

Query: 572 NIWIKPAFALLLHARFLSSLSCLRTPALFVDRCTAPVKLPAW 447
           +I +   F+ LL    L   + LRT     DRC  P+K   W
Sbjct: 31  SILVSLGFSSLLSVILLCIFTLLRTKFNTYDRCIPPMKKSLW 72


>SPBC215.07c |||PWWP domain protein|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 568

 Score = 26.2 bits (55), Expect = 4.4
 Identities = 17/58 (29%), Positives = 27/58 (46%)
 Frame = -1

Query: 327 PLPPNRVSNETMKVVVFQRRSRETTPTYATPLMSPYNARLESSSTGSSFPADSPKPVP 154
           P P     N+T    + ++ +++ T T+   L S    RL +SS  SS PA   +  P
Sbjct: 242 PSPIEEDYNDTKARRITRKGTKKKTVTFDPSLESVPQKRLNASSNVSSNPAKKTRVSP 299


>SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr
            1|||Manual
          Length = 1517

 Score = 25.4 bits (53), Expect = 7.7
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = -3

Query: 589  SPYAY*TSGSSQLLPFCSTRGF 524
            SPYA+ T  S+ L PF STR +
Sbjct: 1211 SPYAFSTVYSNCLNPFISTRSY 1232


>SPCC663.11 |||ww domain binding protein 11 |Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 278

 Score = 25.4 bits (53), Expect = 7.7
 Identities = 11/51 (21%), Positives = 25/51 (49%), Gaps = 1/51 (1%)
 Frame = -2

Query: 482 DRCTAPVKLPAWQCPRTGSRGSFKRRRAFPPRHHSAR-LERNTVRPPILST 333
           D     + LP+ + P    +   K+ ++F P+HH  + +  ++ +P   +T
Sbjct: 148 DESVIDIPLPSEEYPFEDPKPREKKNKSFKPKHHKKQDINASSAQPKSTTT 198


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,871,865
Number of Sequences: 5004
Number of extensions: 60344
Number of successful extensions: 164
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 155
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 163
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 315915086
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).